KEGG   Pantoea sp. At-9b: Pat9b_4132Help
Entry
Pat9b_4132        CDS       T01386                                 

Definition
(GenBank) Cupin 2 conserved barrel domain protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 CENP-C_C AraC_binding MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ADU72696
JGI: Pat9b_4132
UniProt: E6WMR1
Position
pPAT9B04:5266..5613
Genome map
AA seq 115 aa AA seqDB search
MISKDNAEHYVWGEGCDGWYLVKRQDMLVIHEKMPPHTQEKRHYHSVSRQFFFVVKGVLT
MELAGEKQAIAALQGIEIPPEAKHQARNDSDDAVEFIVISHPSTRGDRTDLPDLA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaaagacaatgccgagcactatgtctggggtgaaggctgcgacggatggtat
ctggtcaagcgccaggacatgctggttatccacgaaaaaatgccaccgcatactcaggaa
aaaagacactatcactccgtctccaggcaatttttcttcgtcgtgaaaggcgtactgacc
atggaactggcaggtgaaaaacaggcgatcgctgctttacaaggcatcgagattccccct
gaggcaaaacatcaggccagaaacgacagcgatgatgcggtagaatttattgttatttcc
caccccagcacacgcggcgaccgcactgacctgcctgacttggcgtga

DBGET integrated database retrieval system