KEGG   Pantoea sp. At-9b: Pat9b_4161Help
Entry
Pat9b_4161        CDS       T01386                                 

Definition
(GenBank) hypothetical protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ASCH
Motif
Other DBs
NCBI-ProteinID: ADU72725
JGI: Pat9b_4161
UniProt: E6WMU0
Position
pPAT9B04:34960..35277
Genome map
AA seq 105 aa AA seqDB search
MQSLEIVARLLPEVRSGKKLHTIRWQERKISPGPMLYVNAEDAADMLIVWVTNVETMPLS
AVAHHLGKSKEWPDDVLLAGMREHYPGIDMDSMVEIIHHLPPASD
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgcagagtcttgaaattgttgcacggctgctccctgaggtgcgctccgggaagaaactt
cataccattcgctggcaggaacgtaaaatctcgcccggcccgatgttgtatgttaatgcg
gaggatgccgcagatatgcttattgtctgggtgacaaatgtggagaccatgccgctttct
gccgtggcacaccatcttggcaaatcaaaagagtggccagacgatgtgttgttggccggt
atgcgtgagcattatccggggattgatatggactctatggtggagataatccaccacctt
ccaccagcatcagattga

DBGET integrated database retrieval system