KEGG   Pantoea sp. At-9b: Pat9b_4162Help
Entry
Pat9b_4162        CDS       T01386                                 

Definition
(GenBank) hypothetical protein
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADU72726
JGI: Pat9b_4162
UniProt: E6WMU1
Position
pPAT9B04:complement(35376..35591)
Genome map
AA seq 71 aa AA seqDB search
MKGFGSGTRNRRFMIFLLWMPTVSPLSNAVGPCSPMNTHGLLGVISWIFMLIGAYAFYSG
LFRFYDWFNGK
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgaagggattcggatcgggtacacgtaatcgtcgttttatgatttttttattgtggatg
cctacggtatctcctctttcgaatgcagtcgggccatgtagcccaatgaatacacatggt
ctgctgggggtaatatcctggattttcatgctcattggtgcttacgcgttttattccggt
ttatttcgattttacgactggtttaacggtaaatag

DBGET integrated database retrieval system