KEGG   Pantoea sp. At-9b: Pat9b_4187Help
Entry
Pat9b_4187        CDS       T01386                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_5 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ADU72751
JGI: Pat9b_4187
UniProt: E6WMW6
Position
pPAT9B04:60259..60822
Genome map
AA seq 187 aa AA seqDB search
MNEYAGYTIKWVTLPWERQQAYALRQRVFCQEQGLFVGHDLDDIDRHARLLVALGSVGGW
HDAVVGTVRIHETAPGIWQGSRLAVDSAYRRQGQLGPTLIRLAVCSAHALGCREFYAQVQ
HQNEPLFRRMHWHTLDWLELRGVRHAHMQADLNCYPPCHDPLSGMVISTATRRRVAEIPA
FLTGVTV
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtacgcgggttacaccatcaagtgggtcacgctgccgtgggaacggcagcag
gcttatgcgctgcgccagcgggtcttctgccaggaacaggggctgtttgttgggcatgat
ctggatgatatcgatcgccatgcccgcctgttggtggcgctgggtagtgtcggtggttgg
cacgatgcggtggtcggtacggtgcgcattcatgagacggctcccggtatctggcaggga
tcgcgtctggcggtggatagcgcttatcgtcggcaggggcaactcggcccgacgctgatc
cggctggcagtatgcagcgcgcatgcgcttgggtgccgtgaattttatgcgcaggtgcaa
caccaaaacgaaccgttgtttcgccgtatgcactggcacacgctggactggctggaattg
cgcggtgtacggcatgcgcacatgcaggccgatctcaattgttacccgccctgtcacgac
ccgctcagcggcatggtgattagcacagcgacacgcaggcgggttgcggagataccggca
tttttgacgggggtaacggtatga

DBGET integrated database retrieval system