KEGG   Pantoea sp. At-9b: Pat9b_4214Help
Entry
Pat9b_4214        CDS       T01386                                 

Definition
(GenBank) Tannase and feruloyl esterase
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tannase Peptidase_S9 Esterase
Motif
Other DBs
NCBI-ProteinID: ADU72778
JGI: Pat9b_4214
UniProt: E6WMZ3
Position
pPAT9B04:complement(87171..88952)
Genome map
AA seq 593 aa AA seqDB search
MNAIRNRILGWLVATGVMLLATQVNANVNFAVVKPVMDCGQLAAVNLSDKIGAKVTITAA
TPLKTDKGTYCQVKATIAPAIGVEVALPQQQWTQRFLQVGCGGLCGQINLSPANANGCAP
ATQGEFVVAATDMGHSGGMMDASWAEDPQKRIDFAYRANHLTAQLAKALIQAYYGQAQKY
AYFMGCSDGGREALMEAQRFPDDFDGISAGAPAAFFQFQNSFFHGWNVVANQRADGSAIL
LQDRLPILHRAVLAHCPTLSGVNDGLLANPYACTFSANWVKTCAANQSDKSDCLTTEEIG
VAEKLYRGAYDSAGNQFVVAGLPLGSELRWPVPASADGHSMSEMMALPALQSVLLPGGKQ
NITSMRDFPLNKQNFAAVAQLAPLYNATNTNLSRYMERGGKLIMWHGLADDSVSPAFSIA
YYRGVEAYLGKQATEKFIRLFLLPGVAHCGGGEGLDQIDLLTPLMAWTEQQVAPQALVAG
KSAQPASAGMPPMPPQGKMPAGEANAAAHFHGVQRASSPVASAMPPLKATRPVFPYPSIA
HYTGKGSPDKAENYVAVKSAAYDNLVVGKPASDFIGPNNQKNYVVDGADLKVQ
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaataagaaaccgaatattaggatggctggtagccacaggtgtcatgctgctt
gcgacgcaggtcaatgcgaacgtgaacttcgccgttgtgaagccggtgatggactgtggc
cagttagctgccgtcaacctcagtgataaaattggcgcgaaagtgaccattactgctgca
acgccactgaaaacggacaaaggcacctattgtcaggtcaaagccaccatcgccccggcg
attggagtcgaggtggcactgccgcaacagcagtggacgcaacgcttcttacaggtggga
tgcggtgggttatgcggccagatcaatctcagcccggcgaatgccaacggttgtgcaccg
gccactcagggcgaatttgtcgtcgcggcgactgatatgggccatagcggcggcatgatg
gatgccagttgggcggaagatccacaaaaacgcattgattttgcgtatcgcgccaatcat
ctcaccgcacagctggcaaaagccttgatccaggcatattacggccaggcgcaaaaatac
gcctattttatgggctgctctgatggcgggcgtgaggcgttgatggaagcacaacgcttc
ccggatgattttgatggcatcagcgccggggcaccggcagcgtttttccagttccaaaac
tcctttttccacggctggaatgtggtcgccaatcagcgtgcggacggcagcgcgatcctg
ctgcaagaccgtctgccgattctgcatcgcgccgtactggcacactgcccaaccctgtcg
ggtgtcaatgatggcctgctggctaatccctatgcctgcaccttctccgccaattgggtc
aagacctgtgccgccaaccagagcgataaatcagactgcctgaccacagaagaaattggc
gttgccgaaaaactctatcggggagcttacgacagcgcaggcaatcaatttgtggtggcg
ggtctgccactgggttcagagttacgctggccagtgcccgccagcgccgacggccattca
atgtcggagatgatggcactgcctgcgctgcaatcggtattgttgccaggtggcaagcaa
aacattacctcgatgcgcgatttcccgctgaacaagcaaaatttcgctgctgttgcacag
ctggctccgctatacaacgccaccaacaccaacctgagccgctatatggaacgcggtggt
aagctgattatgtggcacggtttggcggatgactcggttagcccggcgttctccattgct
tactaccgtggcgttgaagcttatctcggtaagcaagccacagaaaaatttatccgcctg
tttctgctgccaggggtagcccactgcggtggtggtgaggggttagatcagatagatttg
ttgacgccgctgatggcctggaccgagcagcaggttgcgccgcaggcgctggtggcaggt
aagtcagcgcaaccagccagtgcgggaatgccgccgatgccgccacaaggcaaaatgccc
gctggcgaggcgaatgccgcagcgcatttccacggcgtacagcgcgccagttcaccagta
gcgtcggcgatgccgccattaaaagccacccgaccggtattcccttatccgtctatcgcg
cactataccgggaaaggatcgccggacaaggcagagaattatgtggcggtgaaatcggcg
gcctatgacaatctggtggtgggtaaaccggccagcgattttattggtccaaataatcaa
aaaaactatgtcgtggacggcgctgacttgaaagtgcagtaa

DBGET integrated database retrieval system