KEGG   Pantoea sp. At-9b: Pat9b_4225Help
Entry
Pat9b_4225        CDS       T01386                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_6 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ADU72789
JGI: Pat9b_4225
UniProt: E6WN04
Position
pPAT9B04:complement(99329..100297)
Genome map
AA seq 322 aa AA seqDB search
MDLLSDVLQLLSAQSYVTTGQTTGTSWSMRYPGFSGMKFMAVRKGKIWFRLEADDNWRAL
LPGDGVIITRSAPFIMASDPALSPVAAESVPYIRKNGLADYGGEDSLLLAGKMEIDPISA
EQLLNVLPVVIPLHSDSESSSTLSWLMSRLHDESLSNRPGSALAGNHLMHLVMIEGFRSW
VLSEAAQLHGWMGALRDARIMRAVTAIHAEPAKSWQLMELAAIAGLSRAGFARCFSATTG
TSPLNYLTHWRMQLASKALRLSTEPIKHLAYRLGYASESTFSTVFRRVYGVAPSAHRAAW
RDGPLQRLSAFRDKLSAPEAAK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggacctgttatctgatgtgcttcagctcctgtcagcacaaagttatgtcaccaccggg
cagaccaccgggacaagctggtcgatgcgctatccgggtttctccggcatgaagtttatg
gcggtgcgcaaaggaaaaatctggttccgcctggaagcggacgacaactggcgggcgctg
ttgcctggagatggggtcattatcacgcgctcggcaccctttatcatggcgtcagacccg
gcgctgtctcccgtcgccgccgaaagcgtgccttacatcagaaaaaatggcctggctgat
tacggtggtgaagacagcctgttgctggcaggaaaaatggagatcgacccgatctctgcg
gaacaactgcttaatgtgctgccggtggtcattccgctgcactcagactcggaatcctcc
tccacgctcagttggctaatgagcagactgcacgatgaaagcctgtctaaccgccccggt
tcggcattggcaggcaatcacctgatgcatctggtgatgattgaagggttccgcagttgg
gtactttctgaggcagcgcaattgcatggctggatgggagccttgcgtgatgcacgcatt
atgcgagccgtcaccgcgatccatgctgaaccggcaaaaagctggcaattgatggagctg
gccgctattgcgggcctgtcgcgcgccgggtttgctcgctgcttcagtgcaaccaccggc
acgtcgccactgaattacctcacccactggcgaatgcagctcgccagcaaagccctccgg
ctcagcaccgaaccgatcaagcatctggcatatcgtctggggtatgcctccgaaagtacc
ttcagcaccgtctttcggcgggtttatggcgtagcaccttccgcccatcgggcggcatgg
cgggatgggccgttgcagcgactttcagccttcagggataaactttccgcacctgaagcc
gcaaaatga

DBGET integrated database retrieval system