KEGG   Pantoea sp. At-9b: Pat9b_4242Help
Entry
Pat9b_4242        CDS       T01386                                 

Definition
(GenBank) transcriptional antiterminator, BglG
  KO
K03488  beta-glucoside operon transcriptional antiterminator
Organism
pao  Pantoea sp. At-9b
Brite
Transcription factors [BR:pao03000]
 Prokaryotic Type
  Other transcription factors
   BglG family
    Pat9b_4242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRD CAT_RBD
Motif
Other DBs
NCBI-ProteinID: ADU72806
JGI: Pat9b_4242
UniProt: E6WN21
Position
pPAT9B04:complement(117291..118118)
Genome map
AA seq 275 aa AA seqDB search
MITVKKSLNNSMLLVEHDQQEMILFGKGIGFGARPGTQVNASGIEQVFIPLEHLKSRHYF
SLTNTIPVAWFDITHDIITLAQAQYAEKLHSVLFFTLTEHLWFAAERARAGQVITNKLSW
EVQRYYQKEYAIGLQARAMVEARFQLELGDDEAVHIAFHLINASGSASQDTAHQQVQLVN
RIAEIVRYKLNVSIDVTSINYNRFITHLRYFAERILAGKISTGAGEDFYQELLKFHPEAM
SVAWTIRDYIQEKYQLSLPKEELTWLSMHISRLQH
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgattacagtgaagaaatcgctgaataacagcatgttgctggtggagcatgatcagcaa
gagatgattctgtttggtaaagggattggctttggtgctcgccccggtacgcaggtgaac
gcgtccgggattgagcaggtgtttatcccgctggaacatctcaagtcacgccactatttc
tcgctgaccaacacgatacccgttgcctggtttgatatcacccatgacatcatcaccctg
gcgcaggctcagtatgctgaaaagctgcattcggtactgtttttcaccctgacggagcat
ctgtggttcgccgctgagcgtgcccgtgcgggtcaggtgatcaccaataagctgagctgg
gaagtgcaacgctattatcagaaagagtacgccattggtttacaggccagagcgatggtg
gaggcccgttttcaactggagctgggtgatgatgaggcggtgcacatcgcattccacctg
attaatgcgtcaggaagtgccagtcaggatacggctcaccagcaggtacaactggtcaac
cgcatcgccgagattgtgcgttacaagttaaatgtgtcgattgatgtgacgtcgattaac
tacaaccgttttattacgcatctgcgttactttgctgaacgcatactggccggaaaaatc
agtacgggtgcgggtgaagacttttaccaggagctgctgaaattccatcctgaagccatg
tccgttgcctggacgattcgcgactatattcaggagaaatatcagttgtcgttgccaaag
gaagaactcacctggctgagtatgcatatcagccgcttacaacactga

DBGET integrated database retrieval system