KEGG   Pantoea sp. At-9b: Pat9b_4250Help
Entry
Pat9b_4250        CDS       T01386                                 

Definition
(GenBank) HAD-superfamily hydrolase, subfamily IIB
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 S6PP Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: ADU72814
JGI: Pat9b_4250
UniProt: E6WN29
Position
pPAT9B04:126427..127233
Genome map
AA seq 268 aa AA seqDB search
MSVIKLIISDLDGTFLNSQGDYDRKLYAEVRQLMQEKGVHFAACTGKQCERVEELFGDNS
RDMWIVGDSATRIKRNGEFLYQSLIDNHLGQQIIATLHQANSDHVVIACTPSGAVIREDT
PTYLAERVRQSYASLHKVEDLSSLKEDFVKITVYDAAGNCPQTRPSLTPFEHQVYIVVAE
AAWIDIANQGVHKGTTIRRLQQMLNIDRHETMAFGDGYNDIELLAEAEYSFAMRNAFDET
KAVANFITRSNDENAVLNTIKRILSLQN
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgattaaattaattatcagcgacctggatggcacctttctgaatagtcagggc
gattatgaccgtaaattatatgcggaagtgcgtcagttgatgcaggaaaaaggtgtccac
tttgcggcctgtaccggtaaacaatgtgaacgcgtggaggagttattcggcgataattct
cgtgatatgtggattgtgggagacagtgccacccgtattaaacgcaacggtgaatttctt
tatcagtcacttattgataatcatctcggacagcaaattattgccaccctgcatcaggcg
aattccgatcatgtggtgatcgcctgtaccccatccggagcagtgatccgtgaagatacc
cccacgtatctggccgagcgtgttcgccagtcctatgccagtctgcataaggtggaggac
ctcagcagcctgaaggaggacttcgtcaaaattacggtctacgatgcagccggaaactgc
ccgcaaacgcgcccatctctgacgccttttgaacatcaggtttatatcgtggtagcagaa
gccgcgtggatcgatattgccaatcagggcgtccacaaaggcaccaccatccggcgactt
cagcaaatgttgaatattgatcgtcatgaaacgatggcgttcggtgacggttataacgat
attgaattgttggcagaagcggaatacagctttgccatgcgtaatgcgtttgacgaaaca
aaagcagtggcgaattttattacccgttccaatgatgagaatgcggtattaaacaccatt
aaacgcattctatcgctgcaaaattaa

DBGET integrated database retrieval system