KEGG   Pantoea sp. At-9b: Pat9b_4253Help
Entry
Pat9b_4253        CDS       T01386                                 

Definition
Xylose isomerase domain protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pao  Pantoea sp. At-9b
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pat9b_4253
   00051 Fructose and mannose metabolism
    Pat9b_4253
Enzymes [BR:pao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Pat9b_4253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B04:complement(130133..131083)
Genome map
AA seq 316 aa AA seqDB search
MKFSSRINSFRSRPELFSAKNNMDTCDLITRMGKAEGLTHIELNYPEHFIGQDKSAIKSC
IADNGLQVGGIALRYNKEFINGEFTNPDEALRNKAINITLDAAEMCKFLGGNTVTLWFGY
DGYDYPFQQDYFRAYELLVSALQQVTQAHPDMQFSFEYKPYEPRTFSFIGDVSSTLMLID
DVGSPNFGITLDFCHMIMKKENPAFSLFLSARKNKLVGFHLNDGYGHFDDGLMLGSVHLM
QTLEYIYYAKRVKFDGLVYFDTFPSREDPVAECAQNIRMYKKLANFIDQVGLEEMERLIR
DQDAIKVQSLLLNLIN
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctcatcacgcatcaactcgtttcgttctcgcccggaattattctcagcgaag
aataatatggatacctgtgaccttattacgcgtatgggcaaagctgaaggattgacccat
atcgaattgaactatcctgagcattttattggtcaggataaatccgctatcaaatcctgc
atcgccgataatggtttgcaagtgggcggcatcgcactccgttataataaagagtttatt
aatggcgaatttaccaaccccgatgaagctttgagaaacaaagccattaatattacgctt
gacgctgcggagatgtgcaaattcctcggcggcaatacggtcacattatggttcggctat
gatggctatgattatcccttccaacaggattatttcagagcctatgaattactggtgagt
gccttgcaacaggtgacgcaggctcatcctgacatgcaattcagctttgagtacaagcct
tatgagccgagaacattttcctttatcggagatgtctcttcaacattaatgttgatcgac
gatgtgggttcaccaaactttggtattactcttgatttctgtcatatgatcatgaaaaaa
gagaacccggctttttcactgttcttatcggcacgcaaaaacaagttggttggatttcat
ctgaatgatggttatggccattttgatgatggactgatgctgggttctgttcacttgatg
cagacgctggaatatatctattatgcaaaacgcgtgaaatttgacgggctggtttatttt
gacaccttccccagccgtgaagatccggtagcagagtgtgcgcaaaatattcgcatgtat
aaaaagctggcgaactttattgaccaagttggtctggaagaaatggagcgtcttatcaga
gatcaggatgcgattaaagtgcagtctctgctgttgaatctcattaattaa

DBGET integrated database retrieval system