KEGG   Pantoea sp. At-9b: Pat9b_4256Help
Entry
Pat9b_4256        CDS       T01386                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR HTH_24 HTH_11 HTH_IclR Fe_dep_repress Rrf2 TrmB PaaX
Motif
Other DBs
NCBI-ProteinID: ADU72820
JGI: Pat9b_4256
UniProt: E6WN35
Position
pPAT9B04:complement(133188..133841)
Genome map
AA seq 217 aa AA seqDB search
MENVNQLRQTNLRDQALSILKLRLLSGDLAPGKIYSASALAEELGVSNSPVREAMLTLVN
QGLMEAVRNRGFRVLPFSDKERENVYELRMLLEIPSMMKLAGLKERIEPRKDEFAKIAAD
MVQFAETGDIAGYLEMDHQFHLGLLSLLENEPLLAIVENLRDQSRQYGLKALRESGGLVK
SAEEHQPILDAMLAGNTELTGELMKNHLSHMVGDWAG
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgtaaatcaattacggcaaaccaatctgagggatcaggcactttctattctg
aagctgcgcctgctatcgggcgatcttgcgccaggcaaaatttactctgcttctgcgctc
gccgaagaattgggcgtttctaacagcccggtgcgcgaagcaatgctgacgctggtaaac
cagggcttgatggaagcggtgcgcaaccgtggcttccgcgtgctgcccttcagcgacaaa
gagcgcgagaacgtttatgaactgcgcatgctgctggaaatcccgtcgatgatgaaactg
gccggtttgaaagaacgtattgagccgcgtaaagacgagttcgccaaaattgccgctgat
atggtgcagtttgccgaaaccggagatatcgcgggctatctggaaatggaccatcagttc
catcttggcctgctgtcgttactggaaaatgaaccactgctggcgattgtggaaaacctg
cgtgatcagtcacgtcagtatggtctgaaggcattacgcgagagtggcggcctggttaaa
tccgccgaagaacatcagccaatccttgatgcgatgctggcaggtaataccgagctgact
ggcgagctgatgaaaaaccatctcagccatatggtgggggactgggcaggctga

DBGET integrated database retrieval system