KEGG   Pantoea sp. At-9b: Pat9b_4258Help
Entry
Pat9b_4258        CDS       T01386                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pao  Pantoea sp. At-9b
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pat9b_4258
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Pat9b_4258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B04:135199..136635
Genome map
AA seq 478 aa AA seqDB search
MEVTDFDVIVIGGGPSGCSAAWELRDRNILVLEKTHRLGGRLYSMSRGDYWLNLGGHLFP
PAGSHMRNILHSIGLDVISIPGNKFAIYWGGKVYKPNAVSALPLTMSMTLRERFALAMRG
LKILKAVKGWQEAMKPVIGENNQRRRARVASYLADESFRDFMGPLPKRLEALFQSAARRA
AAEMEDQHAGVGVSLFGAVWAGKGDSMALNLNGGSGRFGEVMMEMLGDRVRYHTTVKSVK
KVGDKVTVVFESEGREQTVTAAEVIVAVPAHFADQIVQDIPDDVRATLKNVQYGPFPTMG
IITDETGPMPYDDIYAITTPDASFDMFFNHANPLRTGPRKPGGSLMVYSGGAPARAMLKL
TDEEIRDRYLADVYKMFPELKGHVKETIVQRWEPGNTYRPAGFDFQPMLSYCERHDVNIH
FAGDYFAEIGNMEIATGTGHEAARRARTHLMAQEAQQLKMRLAALTQRGTLSAVKEKA
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggaagtaactgattttgatgtcattgttattggtggtggtccttcaggttgttccgca
gcctgggaattgagagatcgtaatattctcgttctggaaaaaacgcatcgtcttggcggg
cgcctctattccatgtcgcgtggtgattactggcttaacctcggggggcacctgtttccg
ccagccggttcgcatatgcgtaatatcctgcattctattggcctggatgtgatcagcatc
ccgggcaacaaatttgccatctattggggcggcaaagtgtacaaacctaacgcggtatcc
gcgctgccattgaccatgtcgatgacgctgcgggagcgttttgcgctggccatgcgcggc
ttgaaaatccttaaagcggtgaaaggctggcaggaagcgatgaaaccggttatcggtgaa
aacaaccagcgccgtcgcgcccgtgtggcaagttatctggcggatgaatctttccgtgat
tttatggggccactgccgaagcgtcttgaggccttattccagtcggctgcgcgtcgtgcg
gcagctgaaatggaagatcagcatgccggggtcggcgtctcactgttcggggccgtgtgg
gcaggtaaaggtgactcgatggcactcaacctgaacggtggttctggtcgttttggcgaa
gtgatgatggagatgctgggcgaccgcgtgcgctatcacaccacggtgaaatccgtgaag
aaagtgggtgacaaagtcacggtggtgttcgagagcgaaggacgtgagcagacggtgacg
gcagctgaagttattgtcgcggtacctgcgcattttgccgatcagatcgtgcaggatatt
cctgatgatgtgcgtgctacgctgaaaaacgtccagtacggccctttcccgaccatgggg
atcatcaccgatgaaaccggaccgatgccgtatgacgatatctacgccatcaccacgccg
gatgcatccttcgatatgttctttaaccacgccaacccattgcgtaccgggccgcgcaaa
ccgggcggtagcctgatggtttattccggcggtgcgccagcccgtgcgatgctgaagctg
accgatgaagagatccgtgatcgttatctggccgacgtctacaaaatgttcccggaactg
aagggacatgtgaaagagaccattgtgcagcggtgggagccggggaatacctaccgtccg
gcaggcttcgattttcaaccgatgctgagttattgcgaacggcatgatgtgaatattcat
ttcgccggtgattactttgccgagatcggcaatatggaaatcgccaccggaacgggccac
gaggccgcacgccgtgcacgtacccatttaatggcgcaggaagcacagcagctgaaaatg
cgactggctgctctgacgcaacgcggcaccctgtcagcggtaaaggagaaagcatga

DBGET integrated database retrieval system