KEGG   Pantoea sp. At-9b: Pat9b_4286Help
Entry
Pat9b_4286        CDS       T01386                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pat9b_4286
   01230 Biosynthesis of amino acids
    Pat9b_4286
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_4286
   00051 Fructose and mannose metabolism
    Pat9b_4286
   00562 Inositol phosphate metabolism
    Pat9b_4286
Enzymes [BR:pao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pat9b_4286
Exosome [BR:pao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pat9b_4286
  Exosomal proteins of bladder cancer cells
   Pat9b_4286
  Exosomal proteins of melanoma cells
   Pat9b_4286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B04:complement(167385..168161)
Genome map
AA seq 258 aa AA seqDB search
MAQPQVWLGVSLKMYFGYQQTLAWCRDVADLAQRHPAIQQGDIGLFVLPAFPAIPAVAEI
FANTPVRFGAQDVCQAANGAWTGEVSASMLQELGCSLAEIGHAERRRHFHEDKTQIAAKV
AMALRHDLTPVLCIGEEQEGQPEQAIALCAQQLAEALADAEQQGLRGNLLFAYEPQWAIG
APQPAPDNYIRAVCDGLRQLPTPQGITLQVIYGGSAGPGLIQRLGDSVNGLFLGRFAHDP
QALAQIVDEASVLLQEIR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaccgcaagtgtggctcggcgtcagcctgaaaatgtactttggctatcagcag
acgctggcatggtgtcgggatgtcgccgatttggcacagcgccatccggccattcagcaa
ggtgatatcgggttgtttgtgctgcccgccttcccggcgatcccggcagtggcagagatc
tttgccaatacgccggtacgctttggcgcgcaggatgtctgccaggcagcaaacggtgcc
tggaccggtgaagtcagcgccagcatgttgcaggaactgggctgttcactggctgaaatt
gggcatgccgaacgccgtcgtcatttccatgaagataaaacccaaatcgccgccaaagtg
gcgatggcgctgcgccacgatttaaccccggtgttgtgcatcggcgaagagcaggaaggc
cagcctgagcaagccattgcgctctgcgcacaacaactggcagaagcgttagcagacgcg
gaacaacagggtctgcgcggcaacctgttgtttgcttacgaaccccaatgggcaattggc
gcgccgcagcccgcaccggacaactacattcgggcggtctgtgacggtctgcgccagtta
cccacaccacaaggcattaccttacaggtgatttacggcggcagcgccgggccggggctg
attcaacgtctgggagacagcgtaaacgggctgtttcttggacgtttcgcccatgacccg
caggcgctggcgcagattgttgatgaagccagtgtgcttttacaggagatccgttaa

DBGET integrated database retrieval system