KEGG   Pantoea sp. At-9b: Pat9b_4392Help
Entry
Pat9b_4392        CDS       T01386                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_4392
Enzymes [BR:pao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Pat9b_4392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B04:286059..287483
Genome map
AA seq 474 aa AA seqDB search
MIYQTQAAFPDGFLWGASTSAYQVEGSWDSDGKGPSVVDMLTHPAGKADFTVASDHYQRM
ESDVALFAQLGLKAYRFSVAWTRVIPDGEGEVNAAGLAFYRRLVDTLCAHGIEPIVTLYH
FDLPWALEEKGGWLNRHTIDAFVRYADVLFNAIGDKVRYWLTINEQNTMILHPGAIGTPP
GCTLPDKKSLYQQSHHMLVAQAQVMQRCHQLLPEAKIGPAINTTSMYAATCRPEDAIAAH
NWETLRCWSFLDVAVHGRYNALALRYLQDRGLAPQILPDDAAQLAAARPDFVAINYYSTA
TIAASRGDASDVAPRAGDQQIMLGEPGVYRPEENPYTAKTPYGWVIDPVGLRLTLRKVCE
RYGLPVMITENGIGAPDTLAADGTIDDGYRIDFLRQHIEQIQLALADGVEVIGYFPWSAI
DVVSTHQGYAKRYGFIYVNRHEQTLNDLRRIPKRSFYWYQQVIASNGHQLQDTR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcagacgcaagccgcattccctgacggttttctctggggcgcttccacctcg
gcttatcaggtggaaggtagctgggacagcgacggcaaaggcccgtcagtggtggatatg
ttgacccatccggcaggcaaggcagatttcaccgtcgccagcgaccattatcaacgcatg
gagagcgatgtggcgttgttcgcgcaacttggtctgaaagcctatcgcttctccgttgcc
tggacgcgggtgatccccgacggggagggtgaggttaatgcggcaggcctggccttttat
cgccgcctggtggataccttgtgcgcccacggcattgaaccgatcgtcacgctgtaccac
ttcgacctgccctgggcgctggaggagaaaggcggctggctgaatcgccataccattgat
gcctttgtgcgttatgccgatgtgctgttcaacgcgatcggcgacaaggtgcgttactgg
ctgacgattaatgaacagaacaccatgattctgcatcccggcgcgattggtacgccgccg
ggatgcaccttaccggataaaaagtcactctatcagcaaagccatcacatgctggtggca
caggcacaggtgatgcagcgttgccatcagttactgcctgaagcgaaaatcggtccggcg
attaacactacctcaatgtatgccgccacctgtcgtcccgaggacgccatcgccgcacat
aactgggaaacgctgcgttgctggagttttcttgatgtcgcggttcatggccgctataac
gccctcgccctgcgctatttacaggatcgcggccttgcgccgcagatattgccggacgat
gcggcgcaactggccgccgcgcgcccggattttgttgccatcaattactactccaccgcc
accattgccgccagccggggggacgcgtccgatgtcgcgccacgtgccggcgatcagcag
attatgttaggcgaacccggagtgtaccgaccggaggagaacccgtacaccgccaaaact
ccttatggctgggtgattgatccggtggggctgcgtttaacgctacgcaaggtgtgcgaa
cgctatggtctgccggtgatgatcaccgaaaacggtatcggcgcgcccgataccctggcc
gcagacggtacgatcgatgatggctatcgcatcgactttctgcgtcagcatattgaacag
atccagctggcgctggcggatggtgttgaggtgatcggctatttcccctggtcggcgatt
gatgtggtcagtacccatcagggctatgcgaaacgctatggtttcatttatgttaatcgc
cacgagcagacgctgaacgatttacggcgcataccaaaacgcagtttttactggtatcaa
caggttatcgccagtaacggacaccaattacaggacacccgttag

DBGET integrated database retrieval system