KEGG   Pantoea sp. At-9b: Pat9b_4522Help
Entry
Pat9b_4522        CDS       T01386                                 

Definition
transcriptional regulator, RpiR family
Organism
pao  Pantoea sp. At-9b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B03:110823..111674
Genome map
AA seq 283 aa AA seqDB search
MLAQQIKDNMAELSPAERKIARAMLADYPGAGLGSVQQLAERAGVSLPSVVRFARRMGFG
GFVDFQQALRDEISEQAKGPLQRLETWVTTESASALMEAAIKSSTLAIQCSLRDIAEYEI
AEATRLIGAKEHHVILGGGRISQSLAMYFGRNLQQVRRGVDVLAENHHDRIQQIIDVNKN
DVFVLFDFRRYQQDMYELAQEIVARGATLIAVTDTQLSPIASLAKVVLAIHVETPWLFDG
YAAGIVLIDAIIASIMESQGDKTVQRLQQWEALGPLSLNAKSK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcacaacagataaaagacaacatggcggaactgagtccggcagagcgcaaaatt
gcccgggcaatgctggccgattaccctggcgctggtttaggttcggtgcagcagctggca
gaacgtgctggcgtcagcctcccttccgtggtgcgtttcgcccgtcgtatgggctttggt
ggctttgtcgattttcagcaggcgttgcgtgatgagatttctgaacaggccaaaggcccg
ttacagcgcctggaaacttgggtgacgacagaaagcgcgtcggccctgatggaagccgcg
attaaatcctccacgctggccattcagtgctcgttacgcgacattgcggaatatgaaatc
gccgaagccacccggctaatcggtgcgaaagaacatcatgtgatcctcggcggtgggcgt
atcagccagtcactggcgatgtattttggccgcaacttgcaacaggtacgacgcggcgta
gacgtgctggccgaaaaccatcatgaccgcatccagcagatcatcgacgtgaataaaaac
gacgtgtttgtgctgtttgattttcgccgctatcagcaggacatgtatgaactggcccag
gagattgtggcgcgtggtgccacgctcatcgccgtgacggatacccaactctctcccatc
gcttctctcgcaaaagtggtactggcgatccatgtggaaacaccgtggctgtttgatggc
tatgccgctggcattgtgctgattgatgccattatcgccagcattatggaaagccagggc
gataaaaccgtgcagcgtttgcagcaatgggaagcgcttggccccctttcgttaaatgca
aaatccaaatga

DBGET integrated database retrieval system