KEGG   Pantoea sp. At-9b: Pat9b_4637Help
Entry
Pat9b_4637        CDS       T01386                                 

Definition
Peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pao  Pantoea sp. At-9b
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pat9b_4637
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pat9b_4637
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pat9b_4637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B03:complement(235679..236161)
Genome map
AA seq 160 aa AA seqDB search
MTTFYQLTATSLGGQLISMADYAGKVVLVVNTASHCGFTPQYGGLEALYKKYAAQGLVVL
GFPCNQFGKQEPGGADEIAQTCHINYGVSFPMFEKVEVNGGAAHPVFRYLKNELPGVLGG
RVKWNFTKFLIGRDGKPLKRFAPFTTPEKMEATILTALKI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccttttatcaacttaccgctaccagtcttggcggccagcttatctctatggcc
gactatgctggaaaggtggttctggtcgttaataccgccagccattgtggattcacgcca
caatacggcggccttgaagcgctttacaagaagtacgccgctcagggtttagtcgtgctt
ggtttcccctgcaaccagttcggcaaacaggaacccggtggtgccgacgagatcgcgcag
acatgtcacattaactacggtgtgagcttcccgatgtttgagaaagttgaggtcaacgga
ggcgctgcgcacccggtgtttcgttatctgaaaaatgaattgcccggcgtgctgggtggg
cgggtcaagtggaacttcactaagttcctgatcggacgtgacggtaaaccgctcaagcgt
tttgccccgttcaccaccccggagaaaatggaagccacaatcctcactgcacttaaaatc
taa

DBGET integrated database retrieval system