KEGG   Pantoea sp. At-9b: Pat9b_5003Help
Entry
Pat9b_5003        CDS       T01386                                 

Definition
Xylose isomerase domain-containing protein TIM barrel
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pao  Pantoea sp. At-9b
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:pao00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pao00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B02:complement(282205..283197)
Genome map
AA seq 330 aa AA seqDB search
MSTWNYPKFGAGLWHFANYVDRYAVDGYGPALSTLEQIRIAGTVEDLSYVDVPYPFTEGV
SVSDVKQALAAAGLKAIGVTPEIYLRRFSRGAFTNPDPVLRKQAFDLMHEAASVVRELGA
NYVKVWPGQDGWDYPFQVDHKNLWRLAVDGMRELASANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEEMGLDNVGILLDFGHALFAGESPAGSAQLIIDHDRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWEGVWQLDQFPFREDNVEAANLSIHFLKHVYRALDKLD
IAGLQAAQAEQNPLLAQRIIQNALLTVIEE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgagtacctggaactacccaaaattcggcgcgggcttgtggcacttcgcaaactatgtt
gaccgttatgcagtcgatggttatggcccggccctgagcacgctggagcaaatccgcatc
gctggcaccgtcgaagacctttcatatgttgacgttccctatcccttcactgagggagtc
agcgtcagtgatgtcaaacaggcgttggctgcggcgggtttgaaagccatcggtgttacc
ccggagatctacttacgtcgtttttctcggggagcgtttactaacccggacccggtacta
cgcaagcaggcatttgatctgatgcatgaagcagccagcgtggtgcgtgagttgggggct
aactatgtcaaggtatggccaggtcaggatggttgggattatccattccaagtcgaccac
aaaaatctctggcggctggcggttgatggcatgcgcgaacttgccagcgccaatccggac
gtaaaatttgccatagagtacaaaccccgcgagccacgggtcaaaatgacatgggattcc
gcagcgaggacgctattgggtattgaggaaatggggctggataatgtcggtattctgctg
gactttgggcatgcattatttgccggcgagtcacctgctggttccgcgcagctgattatc
gatcatgatcgcttgttcggcatggatgtaaacgacaacctgcgcggctgggatgatgac
ctggtggtgggaacggtacatatgacggagatcttcgagttcttttacgtactgaagatc
aataactgggagggagtctggcaattggatcagttcccgttccgtgaggataatgtggaa
gcggctaacctgtcgattcacttcctgaagcatgtgtatcgtgcgttggataagctggat
attgcaggattgcaggctgcgcaagcggaacagaacccgttgctggcgcagaggattatt
cagaatgcgttgctgacggtgattgaggagtga

DBGET integrated database retrieval system