KEGG   Pantoea sp. At-9b: Pat9b_5047Help
Entry
Pat9b_5047        CDS       T01386                                 

Definition
pyridoxal phosphate-dependent enzyme, D-cysteine desulfhydrase family (EC:3.5.99.7)
Organism
pao  Pantoea sp. At-9b
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pPAT9B02:complement(329591..330589)
Genome map
AA seq 332 aa AA seqDB search
MKTVDEFTRVPLGFFPTPLEPLPRLGEVLGINLTIKRDDYSGFGGGGNKVRKLEYLMAEA
CEAGVNVVITTGGHQSNHARMVAAAARKFGMRPVLVLRGNPPASWQGNLLLDKLFGAEVQ
FLDPDGYFTQIEGAMQAHADAAIARGEKPMIIPLGGATPLGALGYVRAIEEISTQLAERA
APVPDFVVAPTGSGGTLAGLHVGTRRYWTETKVIGISVSAKADWFQPRISGMAQDCADLL
QWPQQWQPEDIWIEDGYVGEAYGIPSPGGIDAIYRLAQQEGVLLDPVYTGKAMHGLMSLV
KQDRIPQGANVMFVHCGGSPALYPFADRLLEQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaagacagtcgatgagtttacacgcgtgccgttggggttcttccccacgccgctggag
ccgctaccgcggcttggggaggtattaggcataaatcttaccatcaaacgtgatgattac
agtggcttcggtggcggcggcaataaagtccgcaagctggagtacctgatggcagaagcc
tgtgaggcgggcgttaacgttgtgatcaccaccggaggacatcagtcaaaccacgcccgc
atggtggcagcggcggcgcgtaagtttggtatgcgtccggtgctggtgctacgcggcaac
ccgcctgcaagctggcagggtaatctgttgctcgacaaactgttcggagccgaggtgcaa
ttcctcgacccggatggttatttcacccaaattgaaggtgcgatgcaggcccacgccgat
gcggccatcgcccgtggcgagaagccgatgatcatcccgctgggcggtgccacaccgctc
ggcgcgctaggttatgtgcgtgcgattgaggaaatcagcacgcagcttgctgaacgcgcc
gccccggtgccggatttcgtggtggccccgaccggttccggcggtaccctcgcgggactt
cacgttggaacacgccgttactggaccgagacaaaagtgatcggcatcagcgtcagtgcc
aaagccgactggttccagccgcgcatttcaggcatggcgcaggattgtgccgacctgctg
caatggccacaacagtggcaacctgaggatatctggattgaagatggctatgtcggtgag
gcttacggcatcccgtcaccaggcggcattgacgccatttatcggctggcgcagcaggaa
ggcgtgttactcgacccggtttataccggcaaagcgatgcacgggctgatgtcactggtt
aaacaggatcgcattccgcagggtgctaacgtgatgttcgtgcactgtggcggttctcca
gcgctctatccgtttgccgaccggctactggagcaataa

DBGET integrated database retrieval system