KEGG   Pseudomonas aeruginosa PA7: PSPA7_0038Help
Entry
PSPA7_0038        CDS       T00569                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPA7_0038 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPA7_0038 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSPA7_0038 (trpB)
Enzymes [BR:pap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSPA7_0038 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(37770..38978)
Genome map
AA seq 402 aa AA seqDB search
MTAYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPAFQEELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGM
HGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLAEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDAGVRIVGVEAAGHGIDTGKHAASLNGGVPGVLHGNRTFLLQDADGQI
IDAHSISAGLDYPGIGPEHAWLHDVGRVEYTSITDDEALDAFHTCCRLEGIIPALESSHA
LAEAFKRAPGLPGDHIMVVNLSGRGDKDMQTVMHHMQQEHKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacagcctatcgcaacggccccgacgccaagggcctgttcggccgcttcggcggccag
tacgtcgccgagaccctgatgccgctgatcctcgacctggcccgcgaatacgagaaggcc
aaggacgacccggcgttccaggaggaactggcctacttccagcgcgactatgtcggccgg
ccgagcccgctgtacttcgccgagcgcctgaccgagcactgcggcggggcgaagatctac
ctcaagcgcgaggagctgaaccacaccggcgcgcacaagatcaacaactgcatcggccag
atcctcctggcccggcgcatgggcaagaagcgcatcatcgccgagaccggcgccggcatg
cacggcgtggccaccgccacggtggccgcgcgcttcggcctgcagtgcgtgatctacatg
ggtaccaccgacatcgaccggcagcaggccaacgtgttccgcatgaagctgctgggcgcc
gaggtgatcccggtgaccgccggcaccggcaccctgaaggacgccatgaacgaagcgctg
cgcgactgggtgaccaatgtcgacagcactttctacctgatcggcacggtcgccggcccg
catccgtacccggcgatggtccgcgacttccaggcggtgatcggcaaggagacccgcgaa
cagctggccgagaaggaagggcgcctacccgactcgctagtcgcctgcatcggcggcggc
tccaacgccatgggcctgttccatccgttcctcgacgacgccggtgtgcggatcgtcggc
gtggaggccgccggccacggcatcgataccggcaagcacgcggccagcctgaacggcggc
gtgcccggcgtgctgcacggcaaccgcaccttcctgctgcaggacgcggacggccagatc
atcgacgcgcactccatctccgccggcctcgactaccccggcatcggccccgaacacgcc
tggctgcacgacgtcggtcgggtcgaatacacctcgatcaccgacgacgaggcgctggac
gccttccacacctgctgccgcctcgaaggcatcatcccggcgctggagagttcccacgcc
ctggccgaggcgttcaagcgcgcccccggcctgcccggggaccacatcatggtggtgaac
ctgtccggtcgcggcgacaaggacatgcagaccgtcatgcaccacatgcaacaggagcac
aaagcatga

DBGET integrated database retrieval system