KEGG   Pseudomonas aeruginosa PA7: PSPA7_0253Help
Entry
PSPA7_0253        CDS       T00569                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pap00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPA7_0253
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSPA7_0253
Enzymes [BR:pap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSPA7_0253
Two-component system [BR:pap02022]
 CheA family
  CheA-CheYBV
   PSPA7_0253
Bacterial motility proteins [BR:pap02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSPA7_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(267049..268098)
Genome map
AA seq 349 aa AA seqDB search
MPISVLVVDDSALIRSLLKEIIQADPELRLVGCAPDAFVARDLIRQHAPDVISLDVEMPR
MDGLTFLDKLMKARPTPVLMISSLTERGSEATLRALELGAVDFIAKPRLGIAEGMQAYAE
EIRAKLKTVARARLRRRAADAPAPPESAAPLLSTEKIIALGASTGGTEALKEVLLGLPAN
SPGVVITQHMPPGFTRSFAERLDRLTRLAVSEARDGDRILPGHALIAPGDYHMQVQRSGA
DYMVRLNRQPQVNGHRPAVDVMFESLARCAGRNLLAGLLTGMGRDGARGLLAIRQAGGYT
LAQDEATCVIYGMPREAVELGAAEDVLPLERIAQALLQQACRRGGGNRL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcagcgtcctggtcgtcgacgattccgccctgatccgcagcctgctcaaggag
atcatccaggccgacccggagctgcgcctggtcggctgcgcgccggacgccttcgtcgcc
cgcgacctgatcaggcagcacgcgccggacgtgatcagcctcgacgtggaaatgccgcgg
atggacggtctgaccttcctcgacaagctgatgaaggcgcgaccgaccccggtgctgatg
atctcctcgctcaccgaacgcggttccgaagccaccctgcgcgcgctggaactgggcgcg
gtggacttcatcgccaagccgcgactgggcatcgccgaaggcatgcaggcctacgccgag
gaaatccgcgccaagctcaagaccgtcgcccgcgcccgcctgcggcgccgcgcggcggac
gcgccggcgccgccggagagcgcggcgccgctgctcagcaccgagaagatcatcgccctc
ggcgcttccaccggcggcaccgaggcgctcaaggaagtcctcctcggcctgcctgccaac
agccccggggtagtcatcacccagcacatgccgcccggcttcacccgcagtttcgccgag
cgcctggaccgcctgacccgcctcgccgtcagcgaggcgcgcgacggcgaccgcatcctt
cccgggcatgcgttgatcgcgccgggcgactatcacatgcaggtgcaacgctccggggcc
gactacatggtccgcctgaaccgccagccgcaggtcaacggccaccgtccggcggtcgac
gtgatgttcgagtcgctggcccgctgcgccgggcgcaacctactcgccggcctgctcacc
gggatgggcagggacggcgcgcgcggactgctggcgatccgccaggccggcggctacacc
ctggcccaggacgaggctacctgcgtgatctacggcatgccccgcgaagcggtggaactg
ggcgccgcggaagacgtgctgccgctcgagcggatcgcccaggcgctgctccagcaggct
tgccgacgcggcggcggcaaccgcctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system