KEGG   Pseudomonas aeruginosa PA7: PSPA7_0379Help
Entry
PSPA7_0379        CDS       T00569                                 

Gene name
speB2
Definition
agmatinase (EC:3.5.3.11)
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
Enzymes [BR:pap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     PSPA7_0379 (speB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
386439..387395
Genome map
AA seq 318 aa AA seqDB search
MSNDNPQPLDAAEIPRFAGIPTFMRLPAFTDPAAVRVGLIGVPWDGGTTNRAGARHGPRE
VRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPL
SIGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDP
RRTVQIGIRGSVYSPNDDAFARECGIRVIHMEEFVELGVEATLVEARRVVGDGPTYVSFD
VDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGA
TMMFELLCLLAESAARSA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgacaatccgcagcccctcgacgccgccgagattccccgcttcgccggtatc
ccgaccttcatgcgcctgccggccttcaccgacccggccgcggtgcgggtcggcctgatc
ggcgtgccctgggacggcggcaccaccaaccgcgccggcgcccgccatggcccgcgcgag
gtgcgcaacctgtccagcctgatgcgcaaggtgcatcacgtcagccgcatcgcgccctac
gacctggtgcgggtcggtgacctcggcgacgcgccggtgaatcccatcgacctgctcgat
tcgctgcgccgtatcgaaggtttctatcgccaggtacatgccgccggcaccctgccgctg
tcgatcggcggcgaccacctggtgaccctgccgatctttcgcgccctgggtcgcgagcgg
ccgctgggcatggtgcatttcgatgcgcattccgataccaacgaccgctacttcggcgac
aacccctacacccacggcacgccgttccgccgggccatcgaggagggcctgctcgatccg
cggcgcacggtgcagatcggcatccgcggctcggtgtattcgccgaacgacgacgctttc
gcccgcgaatgcgggatccgggtgatccacatggaggagttcgtcgagctgggcgtcgag
gcgaccctggtcgaagcgcgacgggtagtgggcgacgggccgacctacgtgagtttcgac
gtcgacgtgctcgacccggccttcgcccctggcaccggcaccccggagatcggcggcatg
accagcctccaggcccagcaactggtccgaggcctgcgcgggctggacctggtcggcgcc
gacgtggtcgaggtctcgccgccgttcgatgtcggcggcgccaccgcgctggtcggcgcg
accatgatgttcgaactgctctgcctgctcgccgagtcggccgcgcgaagcgcctga

DBGET integrated database retrieval system