KEGG   Pseudomonas aeruginosa PA7: PSPA7_0532Help
Entry
PSPA7_0532        CDS       T00569                                 

Gene name
ahcY
Definition
S-adenosyl-L-homocysteine hydrolase (EC:3.3.1.1)
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine degradation
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pap00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(549062..550459)
Genome map
AA seq 465 aa AA seqDB search
MTPAGFTDYKVADITLAAWGRRELIIAESEMPALMGLRRKYAGQQPLKGAKILGCIHMTI
QTGVLIETLVALGAEVRWSSCNIFSTQDQAAAAIAAAGIPVFAWKGETEEEYEWCIEQTI
LKDGQPWDANMVLDDGGDLTEILHKKYPQMLERIHGITEETTTGVHRLLDMLKNGTLKVP
AINVNDSVTKSKNDNKYGCRHSLNDAIKRGTDHLLSGKQALVIGYGDVGKGSSQSLRQEG
MIVKVSEVDPICAMQACMDGFEVVSPYKNGINDGTEASIDAALLGKIDLIVTTTGNVNVC
DANMLKALKKRAVVCNIGHFDNEIDTAFMRKNWAWEEVKPQVHKIHRTGKDGFDAHNDDY
LILLAEGRLVNLGNATGHPSRIMDGSFANQVLAQIHLFEQKYADLPAAEKAKRLTVEVLP
KKLDEEVALEMVKGFGGVVTQLTPKQAEYIGVSVEGPFKPDAYRY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgccggtttcaccgactacaaggtcgccgacatcaccctggccgcctggggc
cgccgcgagctgatcatcgccgaatcggaaatgcccgcactgatgggcctgcgccgcaag
tatgccggccagcagccgctgaaaggcgcgaagatcctcggttgcatccacatgaccatc
cagaccggcgtgctgatcgagaccctggtcgcgctgggcgccgaagtccgctggtcgagc
tgcaacatcttctccacccaggaccaggccgccgccgccatcgccgccgccggcatcccg
gtgttcgcctggaagggcgagaccgaggaagagtacgaatggtgcatcgagcagaccatc
ctcaaggacggccagccgtgggacgccaacatggtgctggacgacggcggtgacctgacc
gagatcctgcacaagaaatacccgcagatgctcgagcgcatccacggcatcaccgaagag
accaccaccggggtccaccgcctgctcgacatgctcaagaacggcaccctgaaagtcccg
gcgatcaacgtcaacgactcggtgaccaagagcaagaacgacaacaagtacggctgccgc
catagcctcaacgacgccatcaagcgcggcaccgaccacctgctgtcgggcaagcaggcc
ctggtgatcggctacggcgacgtgggcaagggctcctcgcagtcgctgcgccaggaaggc
atgatcgtcaaggtttccgaagtcgatccgatctgtgccatgcaggcctgcatggacggc
ttcgaagtcgtctcgccgtacaagaacggcatcaacgacggcaccgaggccagcatcgac
gccgcgctgctgggcaagatcgacctgatcgtgaccaccaccggcaacgtcaacgtctgc
gacgccaacatgctcaaggcgctgaagaagcgcgcggtggtctgcaacatcggccacttc
gacaacgagatcgacaccgccttcatgcgcaagaactgggcctgggaagaggtcaagccg
caggtgcacaagatccaccgcaccggcaaggacggtttcgacgcgcacaacgacgactac
ctgatccttctcgccgaaggccgcctggtcaacctgggcaacgccaccggccacccgagc
cggatcatggacggttccttcgccaaccaggtgctggcgcagatccacctgttcgagcag
aagtacgccgacctgccggccgccgagaaggccaagcgcctgaccgtcgaagtgctgccg
aagaagctcgacgaggaagtggccttggagatggtcaagggcttcggcggcgtggtcacc
cagctgacccccaaacaggccgagtacatcggcgtcagcgtggaaggcccgttcaagccg
gacgcctaccgctactaa

DBGET integrated database retrieval system