KEGG   Pseudomonas aeruginosa PA7: PSPA7_0585Help
Entry
PSPA7_0585        CDS       T00569                                 

Gene name
glcB
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00620  Pyruvate metabolism
pap00630  Glyoxylate and dicarboxylate metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPA7_0585 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPA7_0585 (glcB)
Enzymes [BR:pap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSPA7_0585 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABR84414
UniProt: A6UYU5
Structure
PDB: 

Jmol
Position
complement(604713..606890)
Genome map
AA seq 725 aa AA seqDB search
MTERVQVGGLQVAKVLFDFVNNEAIPGTGVSADSFWTGAEAVINDLAPKNKALLAKRDDL
QAKINGWHQARAGQAHDAAAYKAFLEEIGYLLPEAEDFQAGTQNVDDEIARMAGPQLVVP
VMNARFALNASNARWGSLYDALYGTDVISEEGGAEKGKGYNKVRGDKVIAFARAFLDEAA
PLESGSHVDATSYSVKNGALVVALKNGSETGLKNAGQFLAFQGDAAKPQAVLLKHNGLHF
EIQIDPSSPIGQTDAAGVKDVLMEAALTTIMDCEDSVAAVDADDKVVIYRNWLGLMKGNL
AEEVSKGGTTFTRTMNPDRVYTGADGSELTLHGRSLLFVRNVGHLMTNDAILDKHGNEVP
EGIQDGLFTSLIAIHNLNGNTSRKNSRTGSVYIVKPKMHGPEEAAFTNELFGRVEDVLGL
PRNTLKVGIMDEERRTTVNLKACIKAAKDRVVFINTGFLDRTGDEIHTSMEAGAVVRKGA
MKSEKWIGAYENNNVDVGLATGLQGKAQIGKGMWAMPDLMAAMLEQKIGHPLAGANTAWV
PSPTAATLHALHYHKVDVFARQAELAKRTPASVDDILTIPLAPNTNWTAEEIKNEVDNNA
QGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRISSQLLANWLRHGVISQEQVVESL
KRMAVVVDRQNASDPSYRPMAPDFDDNVAFQAALELVVEGTKQPNGYTEPVLHRRRREFK
AKNGL
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacgcgttcaagtcggtggcctgcaggtcgccaaagtcctgttcgacttcgtg
aacaacgaagccatccccggaaccggcgtctctgccgactcgttctggaccggtgcggag
gccgtgatcaacgacctcgcgccgaagaataaagccctgctcgccaagcgcgacgacctc
caggccaagatcaacggctggcaccaggctcgcgccggccaggcccatgacgccgcggcc
tacaaggccttcctcgaggaaatcggctacctgctgcccgaggcggaggacttccaggcc
ggcacccagaacgtcgacgacgagatcgcccgcatggccggcccgcagttggtggtgccg
gtgatgaatgcgcgcttcgccctgaacgcctccaacgcccgctggggttcgctgtacgac
gcgctctacggcaccgacgtgatcagcgaggaaggcggcgcggagaagggcaagggctac
aacaaggttcgcggcgacaaggtcatcgccttcgctcgcgccttcctcgacgaggccgcg
ccgctggagtccggctcccatgtcgacgccacttcctacagcgtgaagaacggcgcgctg
gtcgtggcgctgaagaacggcagcgaaaccggcctgaagaacgccggccagttccttgcc
ttccagggcgatgccgccaagccgcaggccgtgctgctcaagcacaacggcctgcacttc
gaaatccagatcgaccccagcagcccgatcggccagaccgacgccgccggcgtgaaggac
gtgctgatggaagccgccctcaccaccatcatggactgcgaggattcggtcgccgcggtc
gacgccgacgacaaggtagtgatctaccgcaactggctgggcctgatgaagggcaacctg
gccgaggaagtcagcaagggcggcacgaccttcacccgcaccatgaacccggaccgcgtc
tacaccggggccgacggctccgaactgaccctgcacggccgttcgctgctgttcgtccgc
aacgtcggccacctgatgaccaacgacgcgatcctcgacaagcacggcaacgaagtgccg
gaaggcatccaggacggcctgttcaccagcctgatcgccatccacaacctgaacggcaac
accagccgcaagaacagccgcaccggcagcgtgtacatcgtcaagccgaagatgcacggc
ccggaagaggccgccttcaccaacgagctgttcggccgcgtcgaggacgtcctcggcctg
ccgcgcaacacgctgaaagtcggcatcatggacgaggaacgccgcaccaccgtgaacctg
aaggcctgcatcaaggcggccaaggatcgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaagccggcgccgtggtgcgcaagggcgcc
atgaagtcggagaagtggatcggcgcctacgagaacaacaacgtcgatgtcggcctggcc
accggcctgcaaggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctgatg
gccgccatgctcgagcagaagatcggccacccgctggccggcgccaacaccgcctgggtc
ccgtcgccgaccgccgccaccctgcacgccctgcactaccacaaggtcgacgtgttcgcc
cgccaggccgagctggccaagcgcaccccggcctcggtggacgacatcctgaccatcccg
ctggcaccgaacaccaactggaccgcggaagagatcaagaacgaggtggacaacaacgcc
cagggcatcctcggctatgtagtgcgctggatcgaccagggggtcggctgctccaaggta
ccggacatcaacgacgtcggcctgatggaagaccgcgccaccctgcgtatctccagccag
ttgctggccaactggctgcgccacggcgtgatcagccaggagcaggtggtcgagagtctc
aagcgcatggccgtggtggtcgaccggcagaacgccagcgacccgtcctaccggccgatg
gcgccggacttcgacgacaacgtcgcgttccaggcagccctggaactggtggtggaaggc
acgaagcagccgaacggctacaccgagccggtcctgcatcgccgccgtcgcgagttcaag
gcgaagaacgggctgtag

DBGET integrated database retrieval system