KEGG   Pseudomonas aeruginosa PA7: PSPA7_0727Help
Entry
PSPA7_0727        CDS       T00569                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pap00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
728846..729388
Genome map
AA seq 180 aa AA seqDB search
MSLIPVYLGLGSNVERERHLHAGLDALAGFLHDLRCSPVFESEPVGIRSGPFFNLVVSAR
TDLPLAELSLRLKHIEADNGRYAPERKGLPLDIDVLLYGDLVGDFDGLVLPRAEVLKNAF
VLWPLAELAPELEHPLARRAFGELWRESRIPQKLWPAPFEWRGRALTPEALLQAFPRSSL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgatcccggtctacctcggcctcggcagcaatgtcgagcgcgagcgccatctg
catgccggcctcgacgcgctggccggcttcctccatgacctgcgttgctcgccggtgttc
gagagcgagccggtggggatcaggagcggcccgttcttcaacctggtggtatctgcccgc
accgatctgccgctggccgaactgagcctgcggctcaagcacatcgaggccgacaatggc
cgctatgcgccggagcgcaaggggctgccgctggatatcgacgtgctgctgtacggcgac
ctggtcggcgacttcgatggcctggtgctgccgcgcgccgaagtgctgaagaacgccttc
gtgctctggccgctggccgagctggcgccggaactggagcatccgctcgcgcgccgggcg
ttcggagagctctggcgggagtcgcggatcccgcagaaactctggccggcgcccttcgaa
tggcggggccgggctcttacccccgaggcgctgcttcaggcctttccgcgctcttccttg
tag

DBGET integrated database retrieval system