KEGG   Pseudomonas aeruginosa PA7: PSPA7_0935Help
Entry
PSPA7_0935        CDS       T00569                                 

Definition
(GenBank) probable hydrolase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00010  Glycolysis / Gluconeogenesis
pap00020  Citrate cycle (TCA cycle)
pap00620  Pyruvate metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
Module
pap_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_0935
   00020 Citrate cycle (TCA cycle)
    PSPA7_0935
   00620 Pyruvate metabolism
    PSPA7_0935
Enzymes [BR:pap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSPA7_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Abhydrolase_5 Esterase GCV_H Ndr PGAP1
Motif
Other DBs
NCBI-ProteinID: ABR85277
UniProt: A6UZT6
Position
complement(935487..936599)
Genome map
AA seq 370 aa AA seqDB search
MSRIHTLTMPKWGLSMSEGRVDAWLKEEGAHIEKGDEVLDVETDKISSSVEAPFSGVLRR
QVARADETLAVGALLGVVVEGEASEEEIDAVVQRFQAEFVPGHQDAADSGPAPRKVELDG
RVLRYFDRGEGDAPLLLIHGFAGDLNNWLFNHEALAAERRVIALDLPGHGESGKLLARGD
LDELSASVLALLDHLELEHAHLAGHSMGGAVALNCARLAPQRVLSLSLIGSAGLGEEING
DYLRGFVEAANRNALKPQLVQLFSDPALVTRQMLEDMLRYKRLEGVDAALRQLLDNLFAD
GRQRNDLRAVASEGRQPVLAIWGGDDAIIPARHAEGLSAQVEIIPGQAHMVQMEAAEQVN
RLLLDFLRQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccggatccatacgctgaccatgcccaagtggggcctgtcgatgagcgagggccgg
gtggatgcctggctcaaggaagaaggcgcgcacatcgagaaaggcgacgaggtgctcgac
gtggagaccgacaagatctccagcagcgtcgaggcgcccttctccggcgtgctgcggcgc
caggtggcgcgcgcggacgagaccctggcggtcggcgcgctgctcggcgtggtggtcgag
ggcgaggccagcgaggaggagatcgacgccgtggtgcaacgcttccaggccgagttcgtc
cccggccaccaggacgccgcggacagcggaccggccccccgcaaggtcgagctggatggc
cgcgtcctgcgctacttcgaccgtggcgagggagatgcgccgctactgctgatccacggt
ttcgccggcgacctgaacaactggctgttcaaccacgaggcgctggccgccgagcgtcgg
gtgatcgccctggacctgccgggccacggcgagtccggcaagctcctggcgcgcggcgac
ctcgacgaactcagcgccagcgtgctggccctgctcgatcacctcgaactggaacacgcg
cacctggccggccactccatgggcggcgcggtggcgctgaactgcgcgcgcctggcgccg
cagcgggtgctgtcgctgagcctgatcggcagcgccggcctcggcgaggagatcaacggc
gactacctgcgcggcttcgtcgaggcggccaaccgcaacgcgctgaagccacaactggtg
cagttgttctccgacccggcgctggtcacccggcagatgctcgaggacatgctccgctac
aagcgcctggagggcgtcgatgcggccctgcgccagttgctggacaacctgttcgccgac
ggtcgccagcgcaacgacctgcgtgccgtggcgagcgagggccgccagccggtcctggcg
atctggggcggcgatgacgcgatcatcccggcgcggcatgccgagggcctgtcggcccag
gtagagatcattcccggacaggcgcacatggtgcagatggaagccgccgagcaggtcaac
cgcctgctgctcgacttcctccgccagcactga

DBGET integrated database retrieval system