KEGG   Pseudomonas aeruginosa PA7: PSPA7_1182Help
Entry
PSPA7_1182        CDS       T00569                                 

Definition
(GenBank) probable acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00071  Fatty acid degradation
pap00072  Synthesis and degradation of ketone bodies
pap00280  Valine, leucine and isoleucine degradation
pap00310  Lysine degradation
pap00362  Benzoate degradation
pap00380  Tryptophan metabolism
pap00620  Pyruvate metabolism
pap00630  Glyoxylate and dicarboxylate metabolism
pap00640  Propanoate metabolism
pap00650  Butanoate metabolism
pap00900  Terpenoid backbone biosynthesis
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
pap01212  Fatty acid metabolism
pap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPA7_1182
   00630 Glyoxylate and dicarboxylate metabolism
    PSPA7_1182
   00640 Propanoate metabolism
    PSPA7_1182
   00650 Butanoate metabolism
    PSPA7_1182
  Lipid metabolism
   00071 Fatty acid degradation
    PSPA7_1182
   00072 Synthesis and degradation of ketone bodies
    PSPA7_1182
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPA7_1182
   00310 Lysine degradation
    PSPA7_1182
   00380 Tryptophan metabolism
    PSPA7_1182
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPA7_1182
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPA7_1182
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPA7_1182
Enzymes [BR:pap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSPA7_1182
Exosome [BR:pap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPA7_1182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABR82514
UniProt: A6V0I2
Position
complement(1183356..1184531)
Genome map
AA seq 391 aa AA seqDB search
MSDIVIVAGARTPMGGFQGSLAGVSAVELGAVAIREAVQRAGIAADDVQEVIMGCVLPAG
LKQGPARQAALEAGLPAATGCTTINKLCGSGMKAVMLAHDLLKAGTNQVMVAGGMESMSN
APYVLPKARTGLRMGHGEIKDHMFLDGLEDARTGRLMGSFAQETADKYGVTREEMDAYAI
ESLRRAQAAIADGSLAAEIVPVTVTSRKGETVVKDDEQPLTANLEKIPSLKPAFRKDGTI
TAANASSISDGASALVLMTAEEARRRGLKPLARIVGHATQSQDPSEFTLAPIGAMTNLFA
RTGWSKDDVDLFEINEAFAMVTMLAMREHGLDHAKVNVYGGACAQGHPVGSTGSRIILTL
INALRQKGGKRGVASLCIGGGEATAVAVELL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatatcgtcatcgtcgccggcgcccgcactcccatgggcggcttccagggcagc
ctggccggggtttccgcggtcgaactcggcgccgtcgcgatccgcgaggcggtgcagcgc
gccggcatcgccgccgacgacgtgcaggaagtgatcatgggctgcgtcctgcccgccggc
ctgaagcaggggccggcccgccaggccgcgctggaggccgggctgcccgccgccaccggc
tgcaccaccatcaacaagctgtgcggctcggggatgaaggcggtgatgctggcccacgac
ctgctcaaggccggcaccaaccaggtgatggtcgccggcggcatggaaagcatgtccaac
gcgccctacgtgctgccgaaagcccgcaccggcctgcgcatgggccacggcgagatcaag
gaccacatgttcctcgacggcctcgaggacgcccgcactggccgtttgatgggttcgttc
gcccaggagaccgccgacaagtacggcgtgacccgcgaggagatggacgcctatgccatc
gaatcgctcaggcgcgcccaggccgccatcgccgatggctcgctggcggcggaaatcgtc
ccggtcaccgtcaccagccgcaagggcgagaccgtggtgaaggacgacgagcaaccgctg
accgccaacctggagaagatcccgagcctcaagccggcgttccgcaaggacggcaccatc
accgccgcgaatgccagttcgatctccgacggcgcctccgcgctggtcctgatgaccgcc
gaggaagcccggcgccgtggcctgaagccgctggcgcgaatcgtcggccatgccacccag
agccaggacccgagcgagttcaccctggcgccgatcggcgcgatgaccaatctgttcgcc
aggaccggctggagcaaggacgacgtcgacctgttcgagatcaacgaagccttcgccatg
gtcaccatgctcgccatgcgcgaacacggcctcgatcatgccaaggtcaatgtctatggc
ggcgcctgcgcccaaggccacccggtcggctccaccggctcgcggatcatcctcaccctg
atcaacgcactgcgccagaaaggcggcaagcgcggcgtcgcctcgctgtgcatcggcggc
ggcgaagccaccgcggtggcggtcgaactgctctga

DBGET integrated database retrieval system