KEGG   Pseudomonas aeruginosa PA7: PSPA7_1382Help
Entry
PSPA7_1382        CDS       T00569                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
Enzymes [BR:pap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PSPA7_1382 (dsbC)
Secretion system [BR:pap02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSPA7_1382 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1396150..1396878
Genome map
AA seq 242 aa AA seqDB search
MRVTRFLAAAALGLISTLALADNADQNIRKTLQALQPDLPIDSIASSPLPGLYQVQLEGG
RVLYASADGQFVMQGYLYQVKDGKPVNLTEKAESQAIAKAINGVPASEMVVYPAKGQAKA
HITVFTDTTCPYCQKLHAEVPDLTEQGIEVRYMAFPRQGPQSAGDKQLQAVWCAKEPTKA
MDAMMNGKEVKSSECKNPVDKQFQMGQMVGVQGTPAIVLANGQLLPGYQPAKQLAKLALE
AK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccgttttctggctgctgccgccctcggcctgatcagtaccctggccctg
gcagacaatgccgatcagaacatccgcaagaccctgcaggccctgcagccggatctgccc
atcgattccatcgccagcagtccgctgccggggctctaccaggtgcagctggagggcggc
cgggtgctctatgccagcgccgacggccagttcgtcatgcagggctacctgtaccaggtg
aaggacggcaagccggtcaacctgaccgagaaggccgagagccaggcgatcgccaaggcg
atcaacggcgtgcccgccagcgagatggtggtctatccggccaagggccaggccaaggcg
cacatcaccgtgttcaccgacaccacctgcccgtactgccagaagctgcacgccgaagtg
ccggacctgaccgaacagggcatcgaggtgcgctacatggcgttcccgcggcagggcccg
caatcggccggcgacaagcaattgcaggcggtctggtgtgcgaaggagccgaccaaggcg
atggacgccatgatgaacggcaaggaggtcaagtcttccgagtgcaagaacccggtggac
aagcagttccagatgggccagatggtcggggtgcagggtacgccggcgatcgtcctggcc
aacggccagttgctccccggctaccagccggccaagcagttggccaagctggcgctggag
gccaagtag

DBGET integrated database retrieval system