KEGG   Pseudomonas aeruginosa PA7: PSPA7_1384Help
Entry
PSPA7_1384        CDS       T00569                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00260  Glycine, serine and threonine metabolism
pap00750  Vitamin B6 metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01230  Biosynthesis of amino acids
Module
pap_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPA7_1384 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSPA7_1384 (thrC)
Enzymes [BR:pap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSPA7_1384 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABR81018
UniProt: A6V133
Position
1398451..1399860
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTLEEIASWAGLPYHELAFRVMR
PFVAGSIADADFKKILEETYGVFAHDAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIFIMHPYNRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNRYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKASGRLSVEDERWTEARKLFDS
LAVSDEQTCETIAEVYRSCGELLDPHTAIGVRAARECRRSLGVPMVILGTAHPVKFPEAV
EKAGIGQAPALPAHLADLFEREERCTVLPNELAKVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagtacccgcggccaagcgcccgccctgaacttcgaagacgtcctcctc
gccggcctggccagcgacggcggtctctacgtcccggaaaacctgccgcgcttcaccctc
gaggagatcgcttcctgggccggcctgccgtaccacgagctggccttccgggtgatgcgc
ccgttcgtcgccggcagcatcgccgacgccgatttcaagaagatcctcgaggaaacctac
ggcgtcttcgcccatgacgcggtggcgccgctgcgccagctgaacggcaacgagtgggtg
ctcgagctgttccatggcccgaccctggcgttcaaggacttcgccctgcaactgctcggc
cgcctgctcgaccatgtgctggccaagcgcggcgagcgcgtggtgatcatgggcgccact
tccggcgataccggctccgcggccatcgaaggctgccgtcgctgcgacaacgtcgacatc
ttcatcatgcacccgtacaaccgcgtgtccgaggtgcagcgccggcagatgaccaccatc
ctcggcgacaacatccacaacatcgccatcgaaggcaacttcgacgactgccaggagatg
gtcaaggccagcttcgccgaccagggcttcctcaagggtacccgcctggtggcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccacgccgcgctgcag
ctcggcgcgccgcaccgctcggtggcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggtctgccggtcagccaactgatcgtcgcgacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaaccgctacgacaaggacaccctg
cacccgtcgctgtcgccgtcgatggacatcatggtctcctccaacttcgaacgcctgctg
ttcgacctgcacggccgcaacggcaaggccgtcgccgagctgctggacgccttcaaggcc
agcggcaggctgtcggtggaggacgagcgctggaccgaggcgcgcaagctgttcgattcc
ctggcggtcagcgacgagcagacctgcgagaccatcgccgaggtttaccgctcctgtggc
gagctgctcgacccgcacaccgccatcggcgtgcgcgccgcccgcgaatgccggcgcagc
ctgggcgtgccgatggtgatcctgggcaccgcgcacccggtcaagttccccgaggcggtg
gagaaggccggtatcggccaggcgccggcgctgccggcgcacctcgccgatctgttcgag
cgcgaggagcgctgcaccgtattgccgaacgagttggccaaggtacaggctttcgtcagc
cagcacggcaatcgcggcaagccgctctga

DBGET integrated database retrieval system