KEGG   Pseudomonas aeruginosa PA7: PSPA7_1384Help
Entry
PSPA7_1384        CDS       T00569                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPA7_1384 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPA7_1384 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSPA7_1384 (thrC)
Enzymes [BR:pap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSPA7_1384 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1398451..1399860
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLAGLASDGGLYVPENLPRFTLEEIASWAGLPYHELAFRVMR
PFVAGSIADADFKKILEETYGVFAHDAVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDHVLAKRGERVVIMGATSGDTGSAAIEGCRRCDNVDIFIMHPYNRVSEVQRRQMTTI
LGDNIHNIAIEGNFDDCQEMVKASFADQGFLKGTRLVAVNSINWARIMAQIVYYFHAALQ
LGAPHRSVAFSVPTGNFGDIFAGYLARNMGLPVSQLIVATNRNDILHRFMSGNRYDKDTL
HPSLSPSMDIMVSSNFERLLFDLHGRNGKAVAELLDAFKASGRLSVEDERWTEARKLFDS
LAVSDEQTCETIAEVYRSCGELLDPHTAIGVRAARECRRSLGVPMVILGTAHPVKFPEAV
EKAGIGQAPALPAHLADLFEREERCTVLPNELAKVQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacatcagtacccgcggccaagcgcccgccctgaacttcgaagacgtcctcctc
gccggcctggccagcgacggcggtctctacgtcccggaaaacctgccgcgcttcaccctc
gaggagatcgcttcctgggccggcctgccgtaccacgagctggccttccgggtgatgcgc
ccgttcgtcgccggcagcatcgccgacgccgatttcaagaagatcctcgaggaaacctac
ggcgtcttcgcccatgacgcggtggcgccgctgcgccagctgaacggcaacgagtgggtg
ctcgagctgttccatggcccgaccctggcgttcaaggacttcgccctgcaactgctcggc
cgcctgctcgaccatgtgctggccaagcgcggcgagcgcgtggtgatcatgggcgccact
tccggcgataccggctccgcggccatcgaaggctgccgtcgctgcgacaacgtcgacatc
ttcatcatgcacccgtacaaccgcgtgtccgaggtgcagcgccggcagatgaccaccatc
ctcggcgacaacatccacaacatcgccatcgaaggcaacttcgacgactgccaggagatg
gtcaaggccagcttcgccgaccagggcttcctcaagggtacccgcctggtggcggtgaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccacgccgcgctgcag
ctcggcgcgccgcaccgctcggtggcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggctacctggcgcgcaacatgggtctgccggtcagccaactgatcgtcgcgacc
aaccgcaacgacatcctgcaccgcttcatgagcggcaaccgctacgacaaggacaccctg
cacccgtcgctgtcgccgtcgatggacatcatggtctcctccaacttcgaacgcctgctg
ttcgacctgcacggccgcaacggcaaggccgtcgccgagctgctggacgccttcaaggcc
agcggcaggctgtcggtggaggacgagcgctggaccgaggcgcgcaagctgttcgattcc
ctggcggtcagcgacgagcagacctgcgagaccatcgccgaggtttaccgctcctgtggc
gagctgctcgacccgcacaccgccatcggcgtgcgcgccgcccgcgaatgccggcgcagc
ctgggcgtgccgatggtgatcctgggcaccgcgcacccggtcaagttccccgaggcggtg
gagaaggccggtatcggccaggcgccggcgctgccggcgcacctcgccgatctgttcgag
cgcgaggagcgctgcaccgtattgccgaacgagttggccaaggtacaggctttcgtcagc
cagcacggcaatcgcggcaagccgctctga

DBGET integrated database retrieval system