KEGG   Pseudomonas aeruginosa PA7: PSPA7_1435Help
Entry
PSPA7_1435        CDS       T00569                                 

Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pap02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1454917..1455924
Genome map
AA seq 335 aa AA seqDB search
MRIGIVNDMPLAVEALRRALAFEPEHQIVWVAANGAEAVTQCAADTPDVVLMDLLMPVMD
GVEATRRIMAESPCAIVIVTVDIEQNVHRVFEAMGYGALDAVNTPALGIGNPQTAAAPLL
RKIQNVGWLIGQRDSRGKVQVVPPKSGGARQRLVAIGASAGGPASLAVLLKQLPASFNAA
VVLVQHVDEVFAAGMAEWLASESKLPVRLARDGEPPMPGQILLAGTNNHIRLLRNGSLVY
TAEPRSFVYRPSIDVFFESVANFWRGDAVGVLLTGMGRDGAQGLKQMRERGFLTIAQDQA
SCAVYGMPKAAAAIDAAVQILSLEKIAPRLAEVFD
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaggatcggaatcgtcaatgacatgccgctggccgtggaggccctgcgtcgcgccctg
gccttcgagccggagcatcagatcgtctgggtcgccgccaatggcgccgaggcggtgacc
caatgcgccgccgatacccccgacgtggtgctgatggacctgctgatgccggtgatggac
ggggtcgaggcaactcgtcggatcatggcggaaagtccttgcgcgatcgtgatagtcacc
gtcgatatcgagcagaatgtgcatcgagtcttcgaagcgatggggtatggtgcgctcgat
gcggtgaacacgccggcgctgggcatcggcaatccgcagacggcagcggcgccgctgctg
cgcaagatccagaacgtcggctggctgatcggccagcgcgacagccgcggcaaggtccag
gtggttccgccgaagagcggcggggcgcgccagcgcctggtggcgatcggcgcctcggcc
ggcggcccggcgtcgctcgcggtattgctcaagcaactgccggccagtttcaatgccgcc
gtggtgctggtgcagcatgtcgacgaggtgttcgccgccggcatggccgaatggctggcc
agcgaatcgaagctgccggttcgcctggcgcgcgatggcgagccgccgatgccggggcag
atcctgctggcgggtaccaacaaccacatccgcctgttgcgcaacggttcgctggtgtac
accgccgaaccgcgttctttcgtctaccggccgtccatcgacgtgtttttcgagagcgtg
gcgaacttctggcgtggcgacgccgtgggcgttctgctcaccggcatgggccgcgatggc
gcccaggggctcaagcagatgcgcgagcgcggcttcctcaccatcgcccaggaccaggcc
agttgcgcggtctacgggatgccgaaggccgcggcggcgatcgatgccgcggtgcagatc
ctgtccctggagaagatcgccccgcgcctggccgaggtattcgactag

DBGET integrated database retrieval system