KEGG   Pseudomonas aeruginosa PA7: PSPA7_1515Help
Entry
PSPA7_1515        CDS       T00569                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pap  Pseudomonas aeruginosa PA7
Brite
Enzymes [BR:pap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PSPA7_1515 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1540165..1540833
Genome map
AA seq 222 aa AA seqDB search
MSEDLHRRGIGMTSQRTRERLIQRLYEEGLSNARVLEVIRRTPRHLFVDEALAHRAYEDT
ALPIGHNQTISQPFMVARMTELLLAAGPLDKVMEIGTGSGYQTAVLAQLVERVFSVERIQ
ALQDKAKERLAELNLRNVVFRWGDGWEGWSALAPYNGIIVTAAASEVPQSLLDQLAPGGR
LVIPVGGGEVQQLMLIVRTEDGFSRQVLDSVRFVPLLNGPIA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagacctgcaccgccgcggtatcggcatgacttcccagcgtacccgcgaacgc
ctgatccagcggttgtacgaggaaggcctgtcgaatgcccgcgtgctcgaggtgatccgc
cgtacgccgcggcatcttttcgtcgacgaggcgctcgcgcatcgcgcctacgaagacacc
gccctgccgatcggccacaaccagaccatttcccagccgttcatggtggcgcggatgacc
gagttgctgctggccgccggcccgctggacaaggtcatggagatcggcaccggttccggc
taccagaccgcggtgctggcgcaactggtcgagcgggtgttctccgtcgagcggatccag
gcactgcaggacaaggcgaaggaacgtcttgcggagctaaacctgcgcaatgttgtcttt
cgctggggcgacggctgggagggctggtcggcgctggctccctacaatggaatcattgtc
accgcggcggcttcggaagtcccacagtcgctgctggaccagctcgcgccgggcggccgc
ctggtgatcccggtgggtggcggggaagtccagcaactgatgctgatcgtgcgtaccgag
gacggcttcagtcggcaggtgctcgactcggtgcgtttcgtcccgctgctcaacggcccg
atcgcctga

DBGET integrated database retrieval system