KEGG   Pseudomonas aeruginosa PA7: PSPA7_1561Help
Entry
PSPA7_1561        CDS       T00569                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pap00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1587761..1589278)
Genome map
AA seq 505 aa AA seqDB search
MTDKHNKKYVVALDQGTTSSRAIVFDRDANVVSQAQREFAQFYPQAGWVEHDPMEIWATQ
SSTLVEALAQASIEHDQVAAIGITNQRETTVVWDRHSGRPIHNAIVWQCRRSAAICAQLK
RDGLEDYIRETTGLVTDPYFSGTKLKWILDNVEGARERARNGDLLFGTIDTWLIWKLTEG
KVHVTDYTNASRTMLFNIHSLDWDARMLEVLDIPRSMLPEVRNSSEVYGNARIGGVGGGE
LPIAGIAGDQQAALFGQMCVEPGQAKNTYGTGCFLLMHTGDKAVKSTHGLLTTIACGPRG
EVGYALEGAVFNGGSTVQWLRDELKVINDSFDSEYFATKVKDSNGVYLVPAFTGLGAPYW
DPYARGAVFGLTRGVKADHLIRATLESIAYQTRDVLDAMQQDAGERLRALRVDGGAVANN
FLMQFQADILGTRVERPVMRETTALGAAYLAGLACGFWSSLDELKSKAVIERVFEPECDE
PRREKLYAGWKKAVERTRDWDDGER
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagcacaacaagaaatacgtcgtcgccctggaccagggcaccaccagttcc
cgcgccatcgtcttcgaccgcgacgccaacgtggtcagccaggcccagcgcgagttcgcc
cagttctacccgcaggccggctgggtcgagcacgatccgatggaaatctgggccacgcag
agctcgaccctggtcgaggccctggcccaggccagcatcgagcacgaccaggtggccgcc
atcggcatcaccaaccagcgcgagaccacggtggtctgggaccgccacagcggccggccg
atccacaacgcgatcgtctggcagtgccgacgcagcgcggcgatctgcgcgcagctcaag
cgcgacggcctggaagactatatccgcgagaccaccgggctggtcaccgacccgtacttc
tccgggaccaagctgaagtggatcctcgacaacgtcgaaggcgcccgcgaacgcgcgcgc
aatggcgacctgctgttcggcaccatcgacacctggctgatctggaagctcaccgaaggc
aaggtccacgtcaccgactacaccaatgcctcgcggacgatgctgttcaacatccatagc
ctcgactgggacgcgcggatgctcgaggtgctcgacatcccgcgctcgatgctgcccgag
gtgcgcaactcttcggaggtctacggcaacgcccggatcggcggggtcggcggcggcgag
ctgccgatcgccgggatcgccggcgaccagcaggccgccctgttcggccagatgtgcgtg
gagccggggcaggcgaagaacacctatggcaccggctgcttcctgctgatgcacaccggc
gacaaggcggtgaaatccacccacggcctgctcaccaccatcgcctgcggcccgcgcggc
gaggtcggctatgcactggagggcgcggtgttcaacggcggctccacggtgcaatggctg
cgcgacgaactgaaggtgatcaacgactccttcgattccgagtacttcgccaccaaggtc
aaggacagcaacggcgtctacctggtgccggccttcaccggcctcggcgcgccctattgg
gatccctatgcgcgcggcgcggtgttcggcctgacccgcggggtcaaggccgaccacctg
atccgcgccaccctggagtcgatcgcctaccagacccgcgacgtgctcgacgccatgcag
caggacgccggcgagcgcctgcgcgccctgcgcgtggacggcggggcggtggccaacaac
ttcctcatgcagttccaggccgacatcctcggcacccgcgtggaacgtccggtgatgcgc
gagaccaccgccctcggcgccgcctacctggccggcctggcctgcggcttctggagcagc
ctcgacgagctgaagagcaaggcggtgatcgaacgggtgttcgagccggagtgcgacgaa
ccccggcgcgaaaagctctatgccggctggaagaaagccgtggagcgcacccgcgactgg
gacgacggcgagcggtga

DBGET integrated database retrieval system