KEGG   Pseudomonas aeruginosa PA7: PSPA7_1564Help
Entry
PSPA7_1564        CDS       T00569                                 

Gene name
glpK1
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pap00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1590956..1592440
Genome map
AA seq 494 aa AA seqDB search
MSHYLLAIDQGTTSSRAIVFSAQGLPVASCQQEFKQYFPKDGWVEHDGEEIWLTTLQVCR
DALARKGLNAADIAAIGITNQRETTLVWDAASGDLVHPAIVWQDRRTADYCAELKAAGHE
ANVSARTGLLIDPYFSATKLRWILDNVPGARQRAERGELRFGTVDCFLLWRLTGGRSHRT
DATNASRTLLFNIHNQDWDEELLALFGIPRSLLPEVLDCAAEFGVTEPSLLGAAIPVLGM
AGDQQAALIGQACFQPGMVKSTYGTGCFMIQNTGEQPVTSKNRLLTTVGYRLDGKVSYAV
EGSIFVAGAAVQWLRDGIKLIDHAHESEALAIQAGDSNGVYLVPAFTGLGAPYWDPKARG
AIFGLTRDTGIKEIVTAGLQSVCYQTRDLLEAMRQDGTPPSALRVDGGMVVNNWVMQFLT
DILGVTVERPEVTETTALGVAYMAGLKAGFYRDLDDIASHWHLQRRFDAHMAEERRGELY
AGWQNAVRRVRSET
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgtcccactacctccttgccatcgaccagggcaccaccagctcccgcgccatcgtgttc
agtgcccagggcttgccggtggcgagctgccagcaggaattcaagcagtacttcccgaag
gacggctgggtggagcacgacggcgaggaaatctggctgaccacccttcaggtctgccgc
gacgcgcttgcgcgcaagggcctgaacgcggcggacatcgccgccatcggtatcaccaac
cagcgcgagaccacgctggtctgggacgccgccagcggcgacctggtccacccggccatc
gtctggcaggaccgccgtaccgccgactactgcgccgaactcaaggccgccggccacgag
gcgaacgtcagtgcgcgcaccgggctgctgatcgatccttatttctccgccaccaagctg
cgctggatcctcgacaacgtgcccggtgcccgccagcgcgccgaacgcggcgagttgcgc
ttcggcaccgtcgactgcttcctgctctggcgcctgaccggtggccgctcccatcgcacc
gacgcgaccaatgcctcgcgcaccctgctgttcaacatccacaaccaggactgggacgag
gagctgctggcgctgttcgggatcccgcgcagcctgctaccggaggtgctcgactgcgcg
gcggagttcggcgtcaccgagccgtcgctgcttggcgcggcgatcccggtgctgggcatg
gccggcgaccagcaggccgcgctgatcggccaggcctgcttccagccgggcatggtgaag
agtacctacggcaccggctgcttcatgatccagaacaccggcgagcagccggtgacctcg
aagaaccgcctgctcaccacggtcggctaccgcctggacggcaaggtcagctacgccgtg
gaaggcagcatcttcgtcgccggcgccgcggtgcagtggctgcgcgacggcatcaagctg
atcgaccacgcccacgagagcgaagccctggcgatccaggccggcgactccaacggcgtc
tacctggtgccggccttcaccggcctcggcgcgccctactgggacccgaaggcgcgcggc
gcgatcttcggcctgacccgcgacaccgggatcaaggagatcgtcaccgccggcctgcaa
tcggtctgctaccagacccgcgacctgctcgaggcgatgcgccaggacggcacgccgccc
agcgcgctgcgggtggacggcgggatggtggtgaacaactgggtgatgcagttcctcacc
gacatcctcggcgtcaccgtggagcgcccggaagtcaccgagaccaccgccctcggcgtg
gcctacatggctggcctgaaggccggtttctatcgcgacctggacgacatcgccagccac
tggcacctgcagcgccgcttcgacgcgcacatggccgaggagcgtcgcggcgagctctac
gccggttggcagaacgcggtgcggcgggtgcgcagcgagacctga

DBGET integrated database retrieval system