KEGG   Pseudomonas aeruginosa PA7: PSPA7_1598Help
Entry
PSPA7_1598        CDS       T00569                                 

Gene name
algL
Definition
poly(beta-D-mannuronate) lyase
Orthology
K01729  
poly(beta-D-mannuronate) lyase [EC:4.2.2.3]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pap00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1628581..1629684)
Genome map
AA seq 367 aa AA seqDB search
MKTSHLIRITLPGALAAALLASQVSQAADLVPPPGYYAAVGERKGSAGSCPSVPPPYTGS
LVFTSKYEGSDSARATLNAKAEKAFRSQIKDITDMERGATKLVTQYMRSGRDGDLVCALN
WMSAWARAGALQSDDFNHTGKSMRKWALGSLSGAYMRLKFSSSRPLSAHAGQSREIEDWF
ARLGTQVVRDWSNLPLKKINNHSYWAAWSVMSTAVVTNRRDLFDWAVSEFKVAANQVDEQ
GFLPNELKRRQRALAYHNYALPPLAMIAAFAQVNGVDLRQENHGALQRLAERVMNGVDDE
ETFEEKTGEDQDMTDLKVDNKYAWLEPYCALYRCAPKMLEAKKDREPFNSFRLGGEVTRV
FSREGGS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgtcccacctgatccgtatcaccctgcccggcgctctcgccgcggcattgctc
gccagccaggtcagccaggccgccgacctggtgcccccgcccggctactacgcggcggtc
ggcgagcgcaagggcagcgccggcagttgtccgtcggtgccgccgccgtacaccggcagc
ttggtcttcaccagcaagtacgaaggctccgattcggcgcgggcgaccctcaacgccaag
gcggagaaggcgttccgctcgcagatcaaggacatcaccgacatggagcgcggcgccacc
aagctggtcacccagtacatgcgcagcggccgcgacggcgacctggtctgcgcgctgaac
tggatgagcgcctgggcccgcgccggcgccctgcagagcgatgatttcaaccacaccggc
aagtccatgcgcaaatgggcgctgggcagcctctccggcgcctacatgcgcctgaagttc
tccagttcgcgtccgctctcggcccatgccgggcagagccgggagatcgaggactggttc
gcccggctcggcacccaggtggtccgcgactggagcaacctgccgctgaagaagatcaac
aaccattcctactgggcggcctggtcggtgatgtccaccgcggtggtgaccaaccgccgc
gacctcttcgactgggcggtgagcgaattcaaggtcgccgccaaccaggtcgacgagcag
ggcttcctgcccaacgaactcaagcgccgccagcgcgccctcgcctaccacaactacgca
ttgccgccgctggcgatgatcgccgcgttcgcccaggtcaacggcgtcgacctgcgccag
gagaaccacggcgccctgcagcgcctggccgagcgggtgatgaacggggtcgacgacgag
gaaaccttcgaggagaagaccggcgaagaccaggacatgaccgacctcaaggtcgacaac
aagtacgcctggctggagccctactgcgccctctaccgctgcgcgccgaagatgctcgag
gcgaagaaggaccgcgagccgttcaacagcttccgcctcggcggcgaagtgacgcgggtg
ttcagccgcgaagggggaagttga

DBGET integrated database retrieval system