KEGG   Pseudomonas aeruginosa PA7: PSPA7_1690Help
Entry
PSPA7_1690        CDS       T00569                                 

Gene name
folE2
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSPA7_1690 (folE2)
Enzymes [BR:pap01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PSPA7_1690 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1732022..1732582)
Genome map
AA seq 186 aa AA seqDB search
MNPALSQHYREILVGLGEDPQREGLLDTPKRAAKAMQYLCHGYGQTLEEIVNGALFASDN
DEMVIVRDIELYSLCEHHLLPFIGKAHVAYIPTGKVLGLSKVARIVDMFARRLQIQENLT
RQIAEAVRQVTSAAGVAVVIEAQHMCMMMRGVEKQNSQMFTSVMLGAFRESNTTRQEFLQ
LIGRSK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacccagcactttcccagcactaccgggagatcctcgtcggtctcggcgaagacccg
cagcgcgaaggcctgctcgatacccccaagcgcgcggccaaggccatgcagtacctctgc
cacggctacggccagaccctggaggaaatcgtcaacggcgcgctgttcgcctcggacaac
gacgagatggtcatcgtccgcgacatcgagctgtactccctgtgcgaacaccatctcctg
cccttcatcggcaaggcccacgtggcgtacattcccaccggcaaggtgctcggcctgtcg
aaggtggcgcggatcgtcgacatgttcgcccgccgcctgcagatccaggagaacctcacc
cggcagatcgccgaggcggtccgccaggtgaccagcgccgccggcgtggcggtagtgatc
gaggcccagcacatgtgcatgatgatgcgcggggtggagaagcagaactcgcagatgttc
acctcggtgatgctcggcgcgttccgcgagtcgaacaccacccgccaggaatttctgcaa
ctgatcggaaggagcaagtga

DBGET integrated database retrieval system