KEGG   Pseudomonas aeruginosa PA7: PSPA7_1700Help
Entry
PSPA7_1700        CDS       T00569                                 

Definition
(GenBank) probable enoyl CoA-hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00071  Fatty acid degradation
pap00280  Valine, leucine and isoleucine degradation
pap00281  Geraniol degradation
pap00310  Lysine degradation
pap00360  Phenylalanine metabolism
pap00362  Benzoate degradation
pap00380  Tryptophan metabolism
pap00410  beta-Alanine metabolism
pap00627  Aminobenzoate degradation
pap00640  Propanoate metabolism
pap00650  Butanoate metabolism
pap00903  Limonene and pinene degradation
pap00930  Caprolactam degradation
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01212  Fatty acid metabolism
Module
pap_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPA7_1700
   00650 Butanoate metabolism
    PSPA7_1700
  Lipid metabolism
   00071 Fatty acid degradation
    PSPA7_1700
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPA7_1700
   00310 Lysine degradation
    PSPA7_1700
   00360 Phenylalanine metabolism
    PSPA7_1700
   00380 Tryptophan metabolism
    PSPA7_1700
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPA7_1700
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSPA7_1700
   00281 Geraniol degradation
    PSPA7_1700
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPA7_1700
   00627 Aminobenzoate degradation
    PSPA7_1700
   00930 Caprolactam degradation
    PSPA7_1700
Enzymes [BR:pap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSPA7_1700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ABR86673
UniProt: A6V1Z9
Position
1739407..1740177
Genome map
AA seq 256 aa AA seqDB search
MSVIVERNGPVTTLVIARPERRNAVDRPTAQALADALREFEADDTARVAVLTGSGGNFCA
GADLAAVAEDGERRNRLEAEGDGPMGPSRMQLGKPLIAAIEGYAVAGGLELALLADLRVM
AEDAICGVFCRRFGVPLIDGGSVRLPRIVGQGRALDLILTGRPVKADEALQIGLANRVVP
SGSARAEAEELAAELAAFPQTCMLADRASVYAQWELSFDVALANEFQGGLAVIESGETLE
GAQRFRDGEGRHGRFE
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcatcgtcgaacgcaacggcccggtcaccaccctggtcatcgctcgcccggag
cggcgcaatgcggtggaccggccgaccgcccaggccctggccgacgccctgcgcgaattc
gaagcggacgatacggctcgggtcgcggtactcaccggcagcggcggcaatttctgcgcc
ggcgccgacctggcggcggtggccgaggatggcgagcggcgcaatcgcctggaggcggag
ggcgacgggccgatgggaccgagccgcatgcagctcggcaagccgctgatcgccgccatc
gaaggctatgcggtggccggtgggctggagctggcgctgctcgccgacctgcgggtgatg
gccgaggacgccatctgcggagtgttctgccggcgcttcggcgtgccgctgatcgatggc
ggcagcgtgcgcctgccgcggatcgtcgggcagggccgggcgctcgacctgatcctcacc
gggcggccggtgaaggccgacgaagcgttgcagatcggcctggccaaccgggtggtgccg
agcggttcggcgcgagccgaggccgaggaactggcggcggaactcgccgccttcccgcag
acctgcatgctcgccgaccgcgccagcgtatacgcgcagtgggaactgtccttcgacgtg
gccctggccaacgaattccagggcgggctggcggtcatcgagagcggcgagaccctggag
ggcgcgcagcgtttcagggacggcgaggggcgccacgggcgcttcgagtga

DBGET integrated database retrieval system