KEGG   Pseudomonas aeruginosa PA7: PSPA7_1935Help
Entry
PSPA7_1935        CDS       T00569                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPA7_1935 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_1935 (glk)
   00052 Galactose metabolism
    PSPA7_1935 (glk)
   00500 Starch and sucrose metabolism
    PSPA7_1935 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPA7_1935 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPA7_1935 (glk)
   00524 Butirosin and neomycin biosynthesis
    PSPA7_1935 (glk)
Enzymes [BR:pap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSPA7_1935 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1965706..1966725
Genome map
AA seq 339 aa AA seqDB search
MNNDKNGSSGGLALIGDIGGTNARFALWRGQRLESIAVLACADYPRPELAVRDYLARVGE
SLANIDSVCLACAGPVGAGDFRFTNNHWSINRAAFREELGLDHLLLVNDFSTMAWAASRL
GADELVQVRPGSAQADRARLIIGPGTGLGVGSLLPLGEGRWEVLPCEGGHVDLPVTSARD
FAVWESLRERYGHVSAERVLSGNGLLALYEISCALDGIPVRATSAAEVGALALAGDAQAD
AVLEHFFLWLARVAGNAALTVGALGGVYITGGIVPRFRERFLASGFAGAFASRGKTSGAY
LQDVPVWIMTAEHPGLLGAGVALQQALDAESRTGVRATA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgacaagaacggaagttccggcggcctcgccctgattggcgatatcggcggc
accaatgcgcgcttcgcgctctggcgcgggcagcgcctggaatccatcgcggtgctcgcc
tgcgccgattacccgcggccggaactggccgtgcgcgactacctggcgcgggtcggcgag
tcgctggcgaacatcgactcggtctgcctggcctgcgccggtccggtcggcgcgggcgat
ttccgcttcaccaacaaccactggtcgatcaaccgcgccgcgtttcgcgaggaactgggg
ctggatcacctgctgctggtcaacgacttcagcaccatggcctgggccgcctcgcggctg
ggcgcggacgaactggtgcaggtccgccccggcagcgcccaggcggaccgcgcgcggctg
atcatcggccccggtaccggtctgggcgtcggcagcctgctgccgctgggggaggggcgc
tgggaggtgctgccctgcgagggcgggcatgtcgacctgccggtcacctcggcgcgcgat
ttcgccgtctgggaaagtctgcgcgagcgctacggacatgtctccgccgagcgcgtgctg
tccggcaacggcctgctcgctctctatgagatcagctgcgccctcgacgggattcctgtt
cgcgcgaccagtgcggcggaggtcggcgcactggcgctggccggcgacgcccaggccgac
gcggtgctggaacacttcttcctgtggctggcgcgagtcgccggcaatgccgcgctcacc
gtcggcgccctcggcggcgtctacatcaccggcggtatcgtgccgcgcttccgcgaacgc
ttcctcgccagtgggttcgccggggccttcgccagccgcggcaagaccagcggcgcctac
ctgcaggacgtgccggtgtggatcatgaccgccgagcatccgggcctgctcggcgccggc
gttgccttgcagcaggccctggacgccgagagccgaaccggtgtgagagcaaccgcataa

DBGET integrated database retrieval system