KEGG   Pseudomonas aeruginosa PA7: PSPA7_1952Help
Entry
PSPA7_1952        CDS       T00569                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
pap  Pseudomonas aeruginosa PA7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1982205..1983125)
Genome map
AA seq 306 aa AA seqDB search
MAPPKQSNTIDFDAAKQKRGAQPGAGGVPRAGNLMELRQQLTQQLQSSLEAERILGLFFE
EVRQLIPLDALGYRHPGSDLRLEFGSSAKHSVSYRLSHDSDYLGELIFRRRQRLGEEEQR
QLESLLGTLLFPLRNALLYRAAIQTALRDALTGTGNRIAMDQALGRELELARRNLQPLSV
LMLDIDHFKRVNDHYGHAVGDEALKAVAETIKDHLRNVDMVFRFGGEEFLVLLSSTPLQA
ACMVGERLRQAVEELDYRHAGETLKLSISLGCADLRPGEGSDDLLRRVDEALYEAKRDGR
NRLRCA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcccaaacaatccaataccatcgatttcgatgccgccaagcagaagcgcggc
gcgcagcctggcgccggcggagttccccgcgccggcaacctgatggagttgcgccagcaa
ctgacccagcagttgcagagcagcctcgaggcagaacgcatcctcggcctgttcttcgag
gaggtccgccagttgattccgctggacgccctcggctaccgccatccgggctccgacctg
cgcctggaattcggcagcagcgccaagcactcggtgagctaccgcctgagccatgacagc
gactacctcggcgaactgatcttccgccgccgccagcgcctcggcgaagaggaacagcgg
caactggaaagcctgctcggcaccctgctgttcccgctgcgcaacgccctgctctaccgc
gcggcgatccagaccgccctgcgcgacgccctgaccggcaccggcaaccgcatcgccatg
gaccaggcgctcggccgcgaactggaactggcccggcgcaacctgcaaccgctctcggtg
ctgatgctggatatcgaccacttcaagcgggtcaacgaccactacggccacgccgtcggc
gacgaggccctcaaggcggtggcggaaaccatcaaggatcacctgcgcaatgtcgacatg
gtgttccgcttcggcggcgaggaattcctcgtcctgctgtccagcacgccgctgcaggct
gcctgcatggtcggcgaacgtctgcgccaggcggtggaggaactggactaccggcatgcc
ggcgaaacgctgaagctatcgatcagcctcggttgtgccgacctgcggcccggcgaaggc
agcgacgacctgctgcggcgggttgacgaggcgctctacgaggccaagcgcgacggccgc
aatcgcctgcgctgcgcctga

DBGET integrated database retrieval system