KEGG   Pseudomonas aeruginosa PA7: PSPA7_2154Help
Entry
PSPA7_2154        CDS       T00569                                 

Definition
(RefSeq) beta-hexosaminidase
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSPA7_2154
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PSPA7_2154
Enzymes [BR:pap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSPA7_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2208435..2209505
Genome map
AA seq 356 aa AA seqDB search
MQYSVRCLKPVMAGFAVFPAIGLLMQGSLMLDVGGTWLTAEDRQILRHPEVGGLIIFARN
IEHPAQVRELCAAIRAIRPDLLLAVDQEGGRVQRLRQGFVRLPAMRAIADNPNAEELAEH
CGWLMATEVQAVGLDLSFAPVLDLDHQRSAVVGSRAFEGDPERAAQLAGAFIRGMHAAGM
AATGKHFPGHGWAEADSHVAIPEDERSLDEIRRSDLVPFARLAGRLDALMPAHVIYPRVD
PQPAGFSRRWLQEILRGELKFDGVIFSDDLSMAGAHVVGDAASRIEAALAAGCDMGLVCN
DRGSAELALGALQRLKVTPSPRLWRMRGKGHANTDYRQQPRWLAALTALRAAQLID
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtacagtgtgcgctgtctgaagcccgtcatggcgggcttcgctgttttcccggcc
ataggactcctcatgcaaggctctctgatgctcgacgtcggcggcacctggctgaccgcc
gaggaccgccaaatcctgcgccaccccgaggtgggcggtttgatcatcttcgctcgcaac
atcgagcatcccgcccaggttcgcgagttatgcgcggcgattcgcgccatccgccccgac
ctgctgctggccgtcgaccaggaaggagggcgcgtgcagcgcctgcgccagggcttcgtg
cgccttccggcgatgcgcgcgatcgccgacaacccgaacgccgaagagctggccgagcat
tgtggctggctgatggcgaccgaagtacaggcggtcggcctcgacctgagcttcgccccg
gtgctcgacctcgatcaccagcgcagcgccgtggtcggcagtcgcgccttcgagggcgac
cccgagcgcgccgcgcagctcgccggggcgttcatccgcggcatgcacgccgccggcatg
gctgccaccggcaagcattttcccggtcacggctgggcggaggccgattcccatgtggcg
atcccggaagacgagcgcagtctcgacgagatccgccgcagcgacctggtcccgttcgcc
cgcctggccggccggctcgacgcgctgatgccggcccatgtgatctatccgcgggtcgat
ccgcagcccgccggcttttcccggcgctggttgcaggagatcctgcgcggcgagctgaag
ttcgacggggtgatcttcagtgatgacctgtcgatggctggtgcgcatgtggtcggcgac
gccgccagtcgcatcgaggccgccctggccgcgggctgcgacatgggcctggtgtgcaac
gatcgcggttccgccgagctggccctgggtgccctgcagcgcctgaaggtcacgccgtcg
ccgcgcctgtggcgcatgcgcggcaagggccatgcgaataccgattaccgccagcagccg
cgctggctggccgcactgaccgcgctgcgcgcggcgcaactgattgactga

DBGET integrated database retrieval system