KEGG   Pseudomonas aeruginosa PA7: PSPA7_2155Help
Entry
PSPA7_2155        CDS       T00569                                 

Gene name
mtnP
Definition
5'-methylthioadenosine phosphorylase (EC:2.4.2.28)
Orthology
K00772  
5'-methylthioadenosine phosphorylase [EC:2.4.2.28]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pap00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2209516..2210253
Genome map
AA seq 245 aa AA seqDB search
MSVYAIIGGTGLTQLEGLTLSESLPIETPYGAPSAPLQRGRYAGREVLFLARHGHPHRFP
PHQVNYRANLWALKQAGAEAVIAVNAVGGIHAAMGTGHLCVPHQLIDYTSGREHTYFAGD
IEQVTHIDFSHPYDEPLRQRLIEALRALGLEHSSHGVYACTQGPRLETVAEIARLERDGN
DIVGMTGMPEAALARELDLPYACLALVVNPAAGKSVGNITMAEIEQALHDGIGKVREVLA
RVLAG
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctacgcgattatcggagggaccggcctgacccagctggaagggctgaccctg
agcgagtccctgccgatcgagacgccctacggcgcgccatccgcaccgctacagcgcggc
cgctacgccgggcgcgaggtgctgttcctggcccggcacggccatccgcatcgcttcccg
ccgcaccaggtgaactaccgggccaacctctgggccctgaagcaggccggtgccgaggcg
gtgatcgcggtgaacgcggtcggtgggatccatgccgccatgggtaccggtcacctgtgc
gtgccgcaccagttgatcgattatacctccgggcgcgagcacacctacttcgccggcgac
atcgagcaggtcacccatatcgatttcagccatccctatgacgagccgttgcgccagcgc
ctgatcgaggcgctgcgtgcgttggggctggagcacagcagtcatggggtctacgcctgc
acccaggggccgcgcctggagacggtggcggaaatcgcccggctcgagcgcgacggcaac
gacatcgtcggcatgaccggcatgcccgaggcggcattggcgcgcgagctggacctgccc
tacgcctgcctggcgctggtggtcaatcccgcggcgggcaagtcggtaggtaacatcacc
atggccgaaatcgaacaggcattgcacgatggtatcggcaaggtgcgcgaggtgctggcg
cgggtgctggccggctag

DBGET integrated database retrieval system