KEGG   Pseudomonas aeruginosa PA7: PSPA7_2298Help
Entry
PSPA7_2298        CDS       T00569                                 

Gene name
tesA
Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSPA7_2298 (tesA)
Enzymes [BR:pap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSPA7_2298 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSPA7_2298 (tesA)
Lipid biosynthesis proteins [BR:pap01004]
 Fatty acid synthase
  Component type
   PSPA7_2298 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2354968..2355573
Genome map
AA seq 201 aa AA seqDB search
MRALLLSGCLALVLLTQQAAAQTLLVVGDSISAALGLDTSQGWVALLQKRLAEEGYDYRV
VNASISGDTSAGGLARLPALLAEEKPALVVIELGGNDGLRGMAPAQLQQNLAAMAQKARA
EGAKVLLLGIQLPPNYGPRYIEAFSRVYGRVAAQEKTALVPFFLEGVGGVEGMMQADGIH
PALAAQPRLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattgctgttgagcggctgcctggccctggtcctgctgacccagcaggccgcg
gcgcagacgctgttggtcgtgggcgatagtatcagcgccgctttgggactggataccagc
cagggctgggtcgccctgctgcagaagcgtctggccgaggagggttacgactaccgcgtg
gtcaacgcctcgatcagtggtgatacctccgcgggcggcctggcgcgcctgccggcgctg
cttgccgaggaaaaaccggcgctcgtggtgatcgaactgggtggcaacgacggcctgcgc
gggatggccccggcgcaattgcaacagaatcttgccgccatggcgcagaaggcccgcgcg
gaaggggcgaaggtgctgttgctgggtatccagctaccgccgaactacggtccccgctac
atcgaggcgttttccagggtctacggcagggtcgcggcgcaagagaagaccgccctggtg
ccgttctttctcgaaggggtcggcggggtcgaggggatgatgcaggccgacggcatccat
ccggcgctcgccgcccagcccaggcttctggaaaatgtctggccgacactgaaaccgctg
ctttga

DBGET integrated database retrieval system