KEGG   Pseudomonas aeruginosa PA7: PSPA7_2329Help
Entry
PSPA7_2329        CDS       T00569                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSPA7_2329
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSPA7_2329
Enzymes [BR:pap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSPA7_2329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2383812..2384297
Genome map
AA seq 161 aa AA seqDB search
MSDSLLDIPCTTIKGEQKTLADFGGKALLVVNTASKCGFTPQYQGLEALWEKYRERGLVV
LGFPCNQFGKQEPGDEGEISRFCELNYGVSFPLFRKIEVNGAGAHPLFVSLKKRAPGLLG
SQGIKWNFTKFLIGRDGRVVQRYAPTTKPEELGSAIEALLE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcactgctggacattccctgcaccaccatcaagggtgagcagaagaccctg
gccgactttggcggcaaggcgctgctggtggtgaacaccgccagcaagtgcggcttcacc
ccgcagtaccagggactggaggcattgtgggagaaataccgtgagcgcggcctggtggtg
ctcggctttccctgcaaccagttcggcaagcaggagccgggcgacgagggcgagatttcc
cggttctgcgaactgaactacggggtgagcttccctctgttcaggaagatcgaggtcaac
ggcgccggcgcccatccgctgttcgtcagcctgaagaagcgcgcgccgggcctgctcggc
agccagggcatcaagtggaacttcaccaagttcctgatcggccgcgatggccgggtggtg
cagcgctatgcgccgaccaccaagccggaagagcttggctcggcgatcgaggcgctgctt
gaatga

DBGET integrated database retrieval system