KEGG   Pseudomonas aeruginosa PA7: PSPA7_2573Help
Entry
PSPA7_2573        CDS       T00569                                 

Definition
(GenBank) probable isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00630  Glyoxylate and dicarboxylate metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSPA7_2573
Enzymes [BR:pap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSPA7_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABR84453
UniProt: A6V4F2
Position
complement(2594804..2596399)
Genome map
AA seq 531 aa AA seqDB search
MSAYQNEIKAVAALKEKNGSSWSAINPEYAARMRIQNRFKTGLDIAKYTAAIMRKDMAEY
DADSSVYTQSLGCWHGFIGQQKLISIKKHLKTTNKRYLYLSGWMVAALRSDFGPLPDQSM
HEKTAVSGLIEELYTFLRQADARELDLLFTGLDAARAAGDKAKEAELQAQIDNFETHVVP
IIADIDAGFGNAEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHSDFLAKI
NAVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDLYNSFLDCEEISEAELG
NGDVVIKRDGKLLRPKRLASNLFQFRKGTGEDRCVLDCITSLQNGADLLWIETEKPHVGQ
IKAMVDRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAFVAEGKDVSAYDRAKLMSVEYD
DTELAKVADEKIRTFQRDGSAHAGIFHHLITLPTYHTAALSTDNLAKGYFADEGMLAYVK
GVQRQELRQGIACVKHQNMAGSDIGDNHKEYFAGEAALKASGKDNTMNQFH
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatatcagaacgagatcaaggcagttgccgcgctgaaagagaagaacggcagc
agctggagcgcgatcaaccccgagtacgcagctcgcatgcgtatccagaaccgcttcaag
accggcctggatatcgccaagtacaccgcggccatcatgcgcaaggacatggccgagtac
gatgcggactcctccgtctacacccagtcgctgggctgctggcacggtttcatcgggcag
cagaagctgatctcgatcaagaagcacctgaagaccaccaacaagcgctacctctacctg
tccggctggatggtcgccgcgctgcgctccgacttcggcccgctgccggaccagtccatg
cacgagaagaccgcggtttccggcctgatcgaagagctgtacaccttcctgcgccaggct
gacgcccgcgaactggacctgctgttcaccggcctggacgctgcccgcgccgctggcgac
aaggccaaggaagccgagctgcaggcgcagatcgacaacttcgagacccacgtggtaccg
atcatcgccgacatcgacgccggtttcggcaacgccgaggccacctacctgctggccaag
aagatgatcgaagccggcgcctgctgcatccagatcgagaaccaggtgtccgacgagaag
cagtgcggtcaccaggacggcaaggtcactgttccgcacagcgacttcctcgccaagatc
aatgccgttcgctacgccttcctcgaactgggcgtggacgatggcgtgatcgtcgcccgt
accgactccctgggcgccggtctgaccaagcagatcgccgtgaccaacgagccgggcgac
ctgggcgacctgtacaactcgttcctggattgcgaggaaatctccgaggccgagctgggc
aacggcgacgtggtgatcaagcgcgatggcaagctgctgcgtccgaagcgcctggcctcc
aacctgttccagttccgcaagggcactggcgaagaccgctgcgtcctggactgcatcacc
tcgttgcagaacggtgccgacctgctctggatcgaaaccgagaagccacacgtcggccag
atcaaggcgatggtcgaccgcatccgcgaagtgatcccgaacgccaagctggtctacaac
aacagcccgtccttcaactggaccctgaacttccgccagcaggtgttcgatgcgttcgtc
gccgaaggcaaggacgtttccgcctacgaccgcgccaagctgatgagcgtcgagtacgac
gacaccgagctggccaaggtcgccgacgagaagatccgcaccttccagcgtgacggctcg
gcccacgccggcatcttccaccacctgatcaccctgccgacctaccacaccgccgcgctg
tccaccgacaacctggccaagggctacttcgccgacgaaggcatgctggcctacgtgaag
ggcgtgcagcgccaggaactgcgccagggcatcgcctgcgtcaagcaccagaacatggcg
ggttccgacatcggcgacaaccacaaggagtacttcgctggcgaagcggctctgaaggca
agcggcaaggacaacaccatgaaccagttccactga

DBGET integrated database retrieval system