KEGG   Pseudomonas aeruginosa PA7: PSPA7_2681Help
Entry
PSPA7_2681        CDS       T00569                                 

Definition
(GenBank) probable AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
pap00010  Glycolysis / Gluconeogenesis
pap00620  Pyruvate metabolism
pap00640  Propanoate metabolism
pap00680  Methane metabolism
pap01100  Metabolic pathways
pap01110  Biosynthesis of secondary metabolites
pap01120  Microbial metabolism in diverse environments
pap01130  Biosynthesis of antibiotics
pap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPA7_2681
   00620 Pyruvate metabolism
    PSPA7_2681
   00640 Propanoate metabolism
    PSPA7_2681
  Energy metabolism
   00680 Methane metabolism
    PSPA7_2681
Enzymes [BR:pap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSPA7_2681
Lipid biosynthesis proteins [BR:pap01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSPA7_2681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABR83746
UniProt: A6V4Q6
Position
2692899..2694566
Genome map
AA seq 555 aa AA seqDB search
MRDYATTAAGFDLQRTAAATLSGTLQALNACVECCDRHALPGRIALFWEGKDGSRASYTF
SELKALSGRFANFLQAQGVRPGDCVAGLLPRTPELLVTILGAWRLGAVYQPLFTAFGPKA
IEHRVATAGSKVLVTDAANRDKLDELADPPLAVTVGGPKGQGIRRGDFSFWAELERYPAE
FEPVPRSGEDPFLMMFTSGTTGLAKPVPVPLKAILAFVGYLREAVDLRPEDAFWNLADPG
WAYGLYYAVTGPLAMGHPTTFYEGPFSVESTCRIIRDYGITNLAGSPTAYRLLMAAGAAA
EAALKGRLRAVSSAGEPLTPEVIRWFAERLGSTIHDHYGQTELGMVLCNHHALAHPVRIG
AAGFACPGHRVVVLDDALNELPPGQPGILALDRRRSPLMWFPGYQGLETAAFVGDYYLSG
DTVELNEDGSISFVGRADDVITTSGYRVGPFDVESALIEHPAVMEAAVIGKPDPERTELV
KAFVVLCAGHRPTPELADELQRYVRQRLSAHAYPREIEFLEELPKTPSGKIQRFLLRNQE
IARQREAAPLAAAAN
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacgccaccaccgccgccgggttcgatctgcagcggaccgccgccgccacg
ctttccggcacgcttcaggcgctcaacgcctgcgtcgagtgctgcgaccggcatgccctg
ccgggacggatcgcgttgttctgggagggcaaggatggcagtcgcgccagctacaccttc
agcgagctgaaagcgctctccgggcgtttcgccaatttcctccaggcccagggcgtacgc
ccgggcgattgcgtcgccggcctgttgccgcgcacacccgagctgctggtcaccatcctc
ggcgcctggcgcctgggtgcggtgtaccagccgctgttcaccgccttcggcccgaaggcc
atcgagcaccgcgtggcgaccgccggcagcaaggtgctggtcaccgacgcggccaaccgc
gacaagctcgatgaactcgccgatccgcctctggccgtcaccgtcggcggaccgaagggg
cagggcattcgtcgcggcgatttcagcttctgggccgagctggagcgctatccggccgaa
ttcgagccggtcccgcgcagcggcgaggatccgttcctgatgatgttcacctccggcacc
accggcctggccaaaccggtgccggtgccgctgaaggcgatccttgccttcgtcggctac
ctgcgcgaggcggtggacctgcgcccggaggacgccttctggaaccttgccgaccccggc
tgggcctatggcctctactacgcggtcaccggccccctcgccatgggccacccgaccact
ttctacgaaggcccgttcagcgtggaaagcacttgccggatcatccgtgactacggcatc
accaacctcgccggatcgcccaccgcctatcgcctgctgatggctgccggcgcggccgcg
gaagctgcgctgaaggggcgcctgcgcgcggtcagcagcgccggcgaaccgttgacgcca
gaggtgatccgctggttcgccgagaggctcggcagcaccatccacgatcactacgggcag
accgagctgggtatggtgctgtgcaaccaccacgccctggcgcacccggtacggatcggt
gccgccggtttcgcctgtcccggccatcgggtggtggtgctggacgacgcgctcaacgaa
ctgccgcccggccagccgggcatcctcgccctcgaccggcggcgttcgccgctgatgtgg
ttccccggctaccaggggctggagaccgctgccttcgtcggcgactactacctgagcggc
gataccgtcgaactcaacgaggacggcagcatcagcttcgtcggccgcgccgacgacgtc
atcaccacctccggctaccgggtcggcccgttcgacgtggagagcgcgctgatcgagcac
ccggcggtgatggaggcggcggtgatcggcaaacccgatccggagcgcaccgaactggtc
aaggccttcgtcgtgctctgcgccggccaccggccgacgccggagctggcggacgaacta
cagcgatacgtgcgccaacgcctgtcggcgcacgcctacccgcgggagatcgagttcctc
gaggaactgccgaagacccccagcggcaagatccagcgttttctcctgcgcaaccaggag
atcgcccggcaacgcgaggcggcgcccctggcggccgccgcgaactga

DBGET integrated database retrieval system