KEGG   Pseudomonas aeruginosa PA7: PSPA7_3118Help
Entry
PSPA7_3118        CDS       T00569                                 

Definition
cytochrome d ubiquinol oxidase subunit I (EC:1.10.3.-)
Organism
pap  Pseudomonas aeruginosa PA7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3233634..3235076)
Genome map
AA seq 480 aa AA seqDB search
MPALEALDLARLQFAFTISFHILFPAITIGLASYLAVLEGLWLKTNEEVYRDLYHFWSKI
FAVNFGMGVVSGLVMAYQFGTNWSHFSDFAGSITGPLLTYEVLTAFFLEAGFLGVMLFGW
NRVGPGLHFFATVMVAIGTLVSTFWILASNSWMQTPQGFEIVDGRVIPVDWLAVIFNPSF
PYRLLHMSVAAFLATAFFVGASAAWHLLRGRDNPAIRKMLSMAMWMALIVAPVQAVIGDA
HGLNTLEHQPAKIAAIEGHWDNAGGGPTPLILFGWPDMQREETRFKVEIPLLGSLILRHS
LSEPVPALKEFTPQDRPNSTVIFWTFRLMVGLGLLMIATGLYSLWLRWRGGERLYRSPAF
LRLVLLMGPSGLLAILAGWVTTEMGRQPWVVYGLMRTRDAVSAHSAEQLGLSLALFVLVY
FAVFGVGFVYLLRLIRKGPRTAEGRQTEEGGGAGRRQTPARPLSAAGEELEDNQDATGRN
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcactggaagccctggacctggcgcgcttgcaattcgccttcaccatatccttc
cacatcctgtttccggccatcaccatcggcctggccagctacctggcggtgctggaaggg
ctctggctgaaaacgaacgaagaggtctaccgcgacctctatcacttctggtcgaagatc
ttcgcggtcaacttcggcatgggcgtagtgtccggcctggtcatggcctaccagttcggc
accaactggagccacttctccgatttcgccggatccatcaccgggccgctgctgacctac
gaggtgctcaccgcgttcttcctcgaggccggcttccttggcgtcatgctgttcggctgg
aaccgcgtcgggccggggttgcatttcttcgccacggttatggtggcgatcggcacgctg
gtctcgaccttctggatccttgcctccaacagctggatgcagaccccgcagggcttcgag
atcgtcgacggccgggtgatcccggtggactggctggcggtgatcttcaacccgtcgttc
ccctatcgcctgctgcacatgtcggtcgccgcgttcctcgccaccgccttcttcgtcggc
gcctcggcggcctggcacctgctgcgcgggcgcgacaacccggcgatccgcaagatgctc
tcgatggccatgtggatggcgctgatcgtcgccccggtgcaggcggtgatcggcgacgcc
catggtctcaacaccctggagcaccagccggcgaagatcgccgccatcgagggccactgg
gacaacgccggcggcgggccgaccccgctgatcctgttcggctggccggacatgcagcgc
gaggagacccgcttcaaggtggagatcccgctgctcggcagcctgatcctccgccacagc
ctgagcgagccggtcccggcgctgaaggagttcacgccgcaggaccgccccaactcgacg
gtgatcttctggaccttccgcctgatggtcgggctcggcctgctgatgatcgccaccggt
ctctacagcctgtggctccgctggcgcggaggagagcgactgtaccgctcgccggcgttc
ctgcgcctggtgctgctgatgggcccgtccggcctgctcgccatcctcgccggctgggtc
accaccgagatgggccgccagccctgggtcgtctatgggctgatgcgcacccgcgacgcc
gtctcggcgcacagcgccgaacagctgggcctgagcctggcgctgttcgtgctggtctac
ttcgctgtcttcggcgtcggcttcgtctacctgctgcgcctgattcgcaagggaccgcgc
acggcggaagggcggcagacggaggagggcggcggcgccgggcgcagacagacgccggcc
cgcccgctgtcggcggccggcgaggaactggaagacaaccaggacgccaccgggaggaac
tga

DBGET integrated database retrieval system