KEGG   Pseudomonas aeruginosa PA7: PSPA7_3143Help
Entry
PSPA7_3143        CDS       T00569                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPA7_3143 (malQ)
Enzymes [BR:pap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PSPA7_3143 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3253004..3255052
Genome map
AA seq 682 aa AA seqDB search
MSDARLAELAAAVGLQLDWQDAGGRPQRVDPEVQRGLLEALGYPAQSPEQIGQSLAALVR
LREDSANLGLLVGECGQPLEQRLGPAGTPGELVYEDGTRITLRLDAEGRLPAQTRSGYAQ
LVLERQAWAVAIAPPSCPSLASLAPGRARRWGLAAQVYALRRAGDGGLGDSAALEDLLRS
AARHGADALAISPLHALAEDNGHAYSPYSPSSRLFFNVLHAAPATILGAAAVEQAIHRAG
LAAEMARLERLELIDWAAAANLRMRLLRQLHRDFIERASPLRHDLAEFRREGGEALLHHC
RFETLQARLGAGPDWRRWPESLRHPGEPAVAAFCAEHAEEVEFRAFGQWLTQRCLQHAQR
QAREAGMAIGLVADLAVGAEGGGSQAWSRQEELLAEVNVGAPPDILNQSGQDWGVSAFNP
EGLRRHGYRAFREMLQANLAWPGGLRIDHVMGLQRLWLIPRGQPPHAGAYLRYPQRDLLR
LLALEASRASALVIGEDLGTVPEGLREELARRQVLGTRVLLFERHGERFAPPAQWPADAM
ATTSTHDLPSLAGWWRGHDIHWRGRAGLRGAEECAADLELRAEERRALAASLEPPADPAA
EAPLEACIDYVGATPAPLVLLPLEDALGSLEQPNLPGPGDVHPNWRRRWNLNAAQMLDTP
QVERRLRSLDRSRRNAGEDTRD
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgcacgcctggccgaactggccgccgccgtgggcctgcaactcgactggcag
gatgccggcgggcggccgcagcgggtcgacccggaggtccagcgcggcctgctggaagcc
ctcggctatccggcgcagagtccggagcagatcggacagagcctggccgcgctggtccgg
ctgcgcgaggacagcgccaacctcgggctgctggtcggcgaatgcggccagccgctggaa
cagaggctcgggcccgccggcacgccgggcgaactggtctacgaggacggcacgcggatc
accctgcgccttgacgccgaaggccggctgccggcgcagacccgcagcggctacgcgcag
ctggtcctggagcgccaggcgtgggcagtggcgatcgcgccgccgagctgtccgtccctg
gccagcctcgcgcccggccgcgcgcggcgctgggggctggccgcgcaggtctatgcgctg
cgccgcgccggcgatggcgggctgggcgacagcgccgccctcgaggacctgctgcgcagc
gccgcgcggcacggcgccgatgcgctggcgatcagcccgctgcatgcgctggccgaggac
aatggccacgcctacagcccctactcgccgtccagccggctgttcttcaatgtgctgcac
gccgcgccagcgaccatcctcggtgcggccgcggtggaacaggcgatccaccgcgccggc
ctggccgcggagatggcgcgcctggagcgcctcgaactgatcgactgggcggcggccgcg
aacctgcgcatgcgcctgctgcgccaactccaccgtgacttcatcgagcgcgccagtccc
ttgcgccatgacctcgccgaattccgccgcgaaggcggcgaggccctgctccaccactgc
cgcttcgagaccctgcaggcgcgtctcggcgccgggcccgactggcgccgctggccggag
tcgctgcgccaccccggcgagccggcggtggccgcgttctgcgccgagcacgcggaggag
gtggagttccgcgccttcggccaatggctgacccagcgctgcctgcaacatgcccagcgg
caggcgcgggaagccgggatggccatcggcctggtcgccgacctcgcggtgggcgccgag
ggtggcggcagtcaggcctggtcgcggcaggaagagctgctcgccgaggtgaatgtcggc
gcgccgccggacatcctcaaccagtccggccaggactggggcgtatccgcgttcaacccg
gagggcctgcgccgccacggctaccgggcgttccgcgagatgctgcaagccaacctggcc
tggcccggagggctacgcatcgaccatgtgatgggcctgcaacggctctggctgatcccg
cgtggccagccgccccacgccggcgcctacctgcgctatccgcaacgcgacctgctgcgc
ttgctggccctggaagccagccgcgcctcggcgctggtcatcggcgaagacctcggcacc
gtgcccgaaggcctgcgcgaggaactggcacggcgccaggtgctcggtacccgcgtgctg
ctcttcgaacgccacggcgaacgcttcgctcccccggcgcaatggccggcggacgccatg
gccactaccagcacccacgacctgccgagcctggccggctggtggcgcggccacgacatc
cactggcgcggacgcgccggactccgtggcgccgaggagtgcgccgccgacctggaactg
cgggcggaggaacgccgggcgctggccgccagcctcgaaccgccggccgaccctgccgcc
gaggcgccgctggaggcctgcatcgattacgtcggggcgactcccgcgccgctggtgctg
ctgccgctggaggacgccctgggcagcctggagcagccgaacctgcccggtcccggcgac
gtccacccgaactggcggcggcgctggaacctgaacgccgcacagatgctcgacacacca
caggtcgaacgacgcctgcgcagcctcgaccgcagtcgccggaacgccggggaggacacc
cgtgattga

DBGET integrated database retrieval system