KEGG   Pseudomonas aeruginosa PA7: PSPA7_3265Help
Entry
PSPA7_3265        CDS       T00569                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSPA7_3265 (galU)
   00052 Galactose metabolism
    PSPA7_3265 (galU)
   00500 Starch and sucrose metabolism
    PSPA7_3265 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPA7_3265 (galU)
Enzymes [BR:pap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSPA7_3265 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3376404..3377243)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYAVEEALEAGLSEIGIVTGRGKR
SLEDHFDISYELEHQIRNTDKEKYLVGIRRLIDECTFAYTRQVEMKGLGHAILTGRPLIG
DEPFAVVLADDLCLNLEGDSVLKQMVKLYNQFRCSIVAIQEVPPEETNKYGVIAGEMIRD
DIFRVNTMVEKPKPEEAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQD
GCVLAYKFKGKRFDCGSAEGYIEATNFCYENLYKTGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgtcttttcccggccgccggctacggtacccgtttcctcccggccacc
aaggccatgcccaaggaaatgctgccggtggtgaacaagccgctgatccagtacgcggtg
gaggaggcgctggaggccggcctttccgaaatcggcatcgtcaccgggcgcggcaagcgc
tccctggaagaccacttcgacatcagctacgagctggagcaccagatccgcaacaccgac
aaggaaaagtacctcgttggcatccgccggctgatcgacgagtgcaccttcgcctacacc
cgccaggtcgagatgaagggcctcggccatgcgatcctcaccggccgtccgctgatcggc
gacgagccgttcgccgtggtccttgccgacgacctgtgcctgaacctggaaggcgacagt
gtgctgaagcagatggtcaagctgtacaaccagttccgctgctccatcgtggcgatccag
gaagtgccgccggaggaaaccaacaagtacggcgtgatcgccggcgagatgatccgcgac
gacatcttccgggtgaacaccatggtcgagaaaccgaagccggaagaagcaccgtcgaac
ctggcgatcatcggccgctacatcctgaccccggatatcttcgacctgatcgagcagacc
gagccgggcaagggtggcgagatccagatcaccgacgccctgatgaagcaggcccaggac
ggctgcgtgctggcctacaagttcaagggcaagcgtttcgactgcggcagcgccgagggc
tacatcgaggcgaccaacttctgctacgaaaacctctacaagaccggcaaggctcactga

DBGET integrated database retrieval system