KEGG   Pseudomonas aeruginosa PA7: PSPA7_3688Help
Entry
PSPA7_3688        CDS       T00569                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pap01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pap00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pap00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3820260..3821492)
Genome map
AA seq 410 aa AA seqDB search
MAIEIKAPTFPESVADGTVATWHKKPGEAVKRDELIVDIETDKVVIEVLAEADGVLAEII
KNEGDTVLSNELLGKLNEGGAAAPAAPAAAAPAAAPVAQAAAAPAAAGGDDAILSPAARK
LAEEAGIDPNSIAGTGKGGRVTKEDVVAAVEAKKNAPAAPAKPAAPAAEAPIFAAGDRVE
KRVPMTRLRAKVAERLVEAQSAMAMLTTFNEVNMKPIMDLRSKYKDLFEKKHNGVRLGFM
SFFVKAATEALKRFPGVNASIDGNDIVYHGYQDIGVAVSSDRGLVVPVLRNAEFMSLAEI
EGGIANFGKKAKEGKLTIEDMTGGTFTISNGGVFGSLLSTPIVNPPQTAILGMHKIQERP
MAVNGQVVILPMMYLALSYDHRLIDGKEAVSFLVAIKDLLEDPARLLLDV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccaaccttcccggaatcggtcgccgacggcaccgtcgcc
acctggcacaagaagccgggcgaagcggtcaagcgtgacgaactgatcgtcgacatcgag
accgacaaggtcgtcatcgaggttctcgccgaggctgatggcgtgctggccgagatcatc
aagaacgaaggcgacaccgttctgagcaacgagctgctcggcaagctgaacgaaggcggt
gccgccgctccggccgctccggctgccgctgcgcccgccgccgctccggttgcccaggcc
gctgccgctccggctgccgctggcggcgacgatgccatcctgtccccggccgcgcgcaag
ctggccgaggaagccggcatcgacccgaacagcatcgccggcaccggcaagggcggtcgc
gtgaccaaggaagacgtggtcgccgccgtcgaagcgaagaagaacgccccggccgctccg
gccaagcctgccgctccggccgccgaggcgccgatcttcgccgctggcgatcgtgtcgag
aagcgcgtgccgatgacccgcctgcgcgccaaggtcgccgagcgcctggtcgaggcgcag
tccgccatggccatgctgaccaccttcaacgaggtcaacatgaagccgatcatggacctg
cgttcgaagtacaaggacctcttcgagaagaagcacaacggtgttcgcctgggcttcatg
tccttcttcgtcaaggccgccaccgaggcgctgaagcgcttcccgggggtcaacgcctcc
atcgacggcaacgacatcgtctaccacggctaccaggacatcggcgttgccgtttccagt
gatcgtggcctggtggtcccggtcctgcgtaacgccgagttcatgagcctggccgaaatc
gaaggcggcatcgccaacttcggcaagaaggcgaaggaaggcaagctgaccatcgaggac
atgaccggcggtaccttcaccatctccaatggtggcgtgttcggttccctgctctcgacc
ccgatcgtcaacccgccgcagaccgccatcctcggcatgcacaagatccaggagcgcccg
atggccgtgaacggccaggtggtgatcctgccgatgatgtacctggcgctgtcctacgac
caccgtctgatcgacggcaaggaagcggtgagcttcctggtggccatcaaggacctgctg
gaagatccggctcgcctgctgctggacgtctga

DBGET integrated database retrieval system