KEGG   Pseudomonas aeruginosa PA7: PSPA7_3692Help
Entry
PSPA7_3692        CDS       T00569                                 

Gene name
sdhD
Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPA7_3692 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPA7_3692 (sdhD)
   00650 Butanoate metabolism
    PSPA7_3692 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PSPA7_3692 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3827118..3827492)
Genome map
AA seq 124 aa AA seqDB search
MGMVTNVTNFSRSGLYDWMAQRVSAVVLAAYVIFLLGYLIAHPNISYADWHGLFSQGWMR
IFSLLTLVALSVHAWVGMWTISTDYLTPMALGKAATVVRFLFQAVCGMAMFAFFVWGVQI
LWGM
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgggtatggtaactaacgtcacaaacttctcgcgctcgggcctctacgactggatggca
cagcgcgtttccgcggtcgttctcgcggcttatgtcattttcctgctgggctacctcatt
gctcacccgaacatttcctacgcggactggcacggcctgttctcgcagggctggatgcgc
atcttcagcctgttgaccctggttgccctgagcgtccatgcgtgggtcggtatgtggacc
atctccaccgactacctgactccgatggctctcggcaaggcggcgacagtcgtgcgtttc
ctcttccaggcggtctgcggcatggcgatgttcgcattcttcgtctggggtgtgcagatt
ctttggggtatgtga

DBGET integrated database retrieval system