KEGG   Pseudomonas aeruginosa PA7: PSPA7_3778Help
Entry
PSPA7_3778        CDS       T00569                                 

Gene name
ccoO1
Definition
cbb3-type cytochrome c oxidase subunit II (EC:1.9.3.1)
Orthology
K00405  
cytochrome c oxidase cbb3-type subunit II
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Oxidative phosphorylation
Metabolic pathways
Two-component system
Module
Cytochrome c oxidase, cbb3-type
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:pap00190]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pap02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3912553..3913164
Genome map
AA seq 203 aa AA seqDB search
MKNHEILEKNVGLLAIFMVIAVSIGGLTQIVPLFFQDVTNTPVEGMKPRTALELEGRDIY
IREGCVGCHSQMVRPFRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGGRYSDDW
HRAHLYNPRNVVPESKMPAYPWLVENKLDGKDTATKMEVLRKLGVPYTDEDIAGAREAVK
GKTEMDALVAFLQGLGTSIKSKR
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccacgaaatactcgagaagaacgtcggcctgctggccatcttcatggtgatc
gccgtcagcatcggcggcctgacccagatcgtgccgctgttcttccaggacgtgaccaat
accccggtcgaaggcatgaagccgcgcaccgccctggaactggaaggccgcgacatctac
atccgcgaaggctgcgtcggctgccactcgcagatggtccgtccgttccgtgccgaaacc
gaacgctacggccactactcggtcgccggtgagagcgtctgggaccacccgttcctgtgg
ggttccaagcgtaccggcccggacctggcccgcgtcggcggccgttactccgacgactgg
caccgcgcgcacctgtacaacccgcgcaacgtggtacccgagtcgaagatgcctgcctac
ccgtggctggtagagaacaagcttgatggcaaggacaccgccaccaagatggaagtcctg
cgcaagctgggcgtgccttacaccgacgaggacatcgccggtgcacgtgaagccgtgaag
ggcaagaccgagatggacgccctggtggcgttccttcaaggcctgggaacctctatcaag
agcaaacggtga

DBGET integrated database retrieval system