KEGG   Pseudomonas aeruginosa PA7: PSPA7_3799Help
Entry
PSPA7_3799        CDS       T00569                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pap03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3930788..3931384)
Genome map
AA seq 198 aa AA seqDB search
MSFSPLIRQLIESLRILPGVGQKSAQRMALMLLERDRSGGLKLAQALTAAMEGVGHCRQC
RTLSEEELCPQCADPRRDDSLLCVVEGPLDVFAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPELDARIRDGAFSEVILATNPTVEGEATAHYIAQLLADRGLTLSRIAHGVPLGGELE
LVDGGTLAHALAGRRPIS
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcagcccgctgatccgccaactgatcgagtccctgcgcattcttcccggtgtc
gggcagaagtcggcccagcgcatggcgctgatgctgctggagcgcgatcgcagcggcggc
ctgaagctggcccaggcgttgaccgccgcgatggagggtgtcggtcactgccggcaatgc
cgtaccctcagcgaagaggaactgtgcccgcagtgcgcggatccgcgacgcgacgactcg
ctgctctgcgtggtggaggggccgctggatgtgttcgccgtggaacagaccggttaccgt
ggccgctatttcgtgctcaagggtcatctgtcgccgctcgacgggctggggccggaagcg
atcggcattcccgagctggacgcgaggatcagggacggcgccttcagcgaagtgatcctc
gccaccaacccgaccgtggaaggcgaggccaccgcccactacatcgcgcaactgctggcc
gatcgcggcctgaccctgtcgcgcatcgcccacggcgtgccgctgggcggcgagttggag
ctggtcgatggcggcaccctggcccatgccctggccggccgtcggccgatctcctga

DBGET integrated database retrieval system