KEGG   Pseudomonas aeruginosa PA7: PSPA7_4989Help
Entry
PSPA7_4989        CDS       T00569                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pap  Pseudomonas aeruginosa PA7
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pap00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:pap00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5146115..5147578)
Genome map
AA seq 487 aa AA seqDB search
MPMSLNQLFPQAERDLLIRELTLDSRGVRPGDLFLAVPGGRQDGRAHIADALAKGAAAVA
YEAEGAGELPPSDAPLIAVKGLAAQLSAVAGRFYGEPSRGLDLIGVTGTNGKTSVSQLVA
QALDLLGERCGIVGTLGTGFYGALESGRHTTPDPLAVQATLATLKQAGARAVAMEVSSHG
LDQGRVAALGFDIAVFTNLSRDHLDYHGSMEAYAAAKAKLFAWPGLRCRVVNLDDDFGRR
LAGEEQYSELITYSLTDSSAFLYCREARFGDAGIEAALVTPHGEGLLRSPLLGRFNLSNL
LAAVGALLGLGYPLGDILRTLPQLQGPVGRMQRLGGGDKPLVVVDYAHTPDALEKVLEAL
RPHAAARLLCLFGCGGDRDAGKRPLMAAIAERLADGVLVTDDNPRTEASAAIIADIRKGF
AAADKVTFLPSRGEAIAHLIASAAVDDVVLLAGKGHEDYQEIDGVRHPFSDIEQAERALA
AWEVPHA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcctatgagcctgaaccaactgtttccccaggccgagcgcgatctgctgatccgcgag
ctgaccctggatagccgcggcgttcgtccgggcgacctgttcctggcggtgccgggcggg
cgccaggatggtcgtgcgcacatcgccgatgccctggccaagggcgcggctgccgtggct
tacgaggcggaaggcgccggagagttgccgcccagcgatgcgccgctgatcgcggtgaag
gggctggccgcgcaactgtcggcggtcgccgggcgtttctacggcgagccgagccgcggg
ctggacctgatcggcgtcaccggcaccaatggcaagaccagcgtcagccaactggtggcc
caggccctcgacctgctcggcgagcgctgcggcatcgtcggtaccctcggcaccggtttc
tatggcgcgctggaaagcggccgccacactaccccggacccgctcgccgtgcaggccacg
ctggccacgctgaagcaggccggcgcccgcgcggtagcgatggaagtgtcttcccacggc
ctcgaccaggggcgcgtggcggcgctcggtttcgatatcgcggtgttcaccaacctgtcc
cgcgaccacctcgactatcacggctcgatggaggcctacgccgccgccaaggccaagctg
ttcgcctggccgggcctgcgctgccgggtggtcaacctggacgacgatttcggccgtcga
ctggccggcgaggagcagtactcggagctgatcacctacagcctcaccgacagctcggcg
ttcctctattgccgcgaagcgcgcttcggcgacgccggcatcgaggcggcgctggtcact
ccgcacggcgagggcctgctgcgcagcccgttgctcggccgcttcaacctgagcaacctg
ctggcggcggtcggtgcgttgcttggcctgggttatcccctgggcgatatcctccgcacc
ttgccgcaactgcaggggccggtcggccgcatgcagcgcctgggaggcggcgacaagccg
ctggtggtggtggactacgcgcatactcccgacgccctggaaaaagtcctggaggccctg
cgtccgcacgcggccgcgcgcctgctatgcctgttcggctgcggtggcgatcgcgatgcc
ggcaagcgtccgctgatggctgcgatcgccgaacgcctggcggatggggtgctggtcacc
gacgacaacccgcgcaccgaggccagtgcggcgatcatcgccgatatccgcaaaggcttc
gctgccgctgacaaggttaccttcctgccgtcgcgcggtgaggcgatcgcccatctgatt
gcttccgctgcggtggatgacgtggtgctcctggccggcaagggtcacgaggattatcag
gagatcgacggcgtacgccatccgttctccgacatcgagcaggccgagcgcgccctggcc
gcctgggaggtgccgcatgcttga

DBGET integrated database retrieval system